Clone Name | rbastl56b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ISP4_SCHPO (P40900) Sexual differentiation process protein isp4 | 29 | 2.5 |
---|
>ISP4_SCHPO (P40900) Sexual differentiation process protein isp4| Length = 785 Score = 29.3 bits (64), Expect = 2.5 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +1 Query: 70 YKS*RILTISTSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGVDVITSMQKAL 249 Y++ + +ST+ A F L ++ I S + +I+ ++ ++ D+ + KA Sbjct: 400 YQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEI-YDRLRDPPAPDIHEKLMKAY 458 Query: 250 NGVFWYIYYSTVHNRIMGYLSGSK*SWRNETP 345 + V +Y +Y +V G + G+ W+ ETP Sbjct: 459 DEVPFY-WYLSVFLAFFGMMMGTIYGWKTETP 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,859,443 Number of Sequences: 219361 Number of extensions: 900217 Number of successful extensions: 1743 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1743 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)