| Clone Name | rbastl56b02 |
|---|---|
| Clone Library Name | barley_pub |
>MARCS_BOVIN (P12624) Myristoylated alanine-rich C-kinase substrate (MARCKS)| (ACAMP-81) Length = 331 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 322 EGAAAGNGSPTPLMARVASTTSSYETPK 239 EG AA GSPT AS SS +PK Sbjct: 108 EGGAAEPGSPTAAEGEAASAASSSSSPK 135
>LEU3_SYNEL (P59029) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 361 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 279 AISGVGEPFPAAAPSHCRQ 335 AI VGEP PAA + CRQ Sbjct: 49 AIDAVGEPLPAATLATCRQ 67
>TRXB_BORBU (P94284) Thioredoxin reductase (EC 1.8.1.9) (TRXR)| Length = 326 Score = 27.3 bits (59), Expect = 9.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 80 LFWNEGSTICILGQRHLF 27 LFWN+G ++C + HLF Sbjct: 147 LFWNKGISVCAICDGHLF 164
>MARCS_HUMAN (P29966) Myristoylated alanine-rich C-kinase substrate (MARCKS)| (Protein kinase C substrate, 80 kDa protein, light chain) (PKCSL) (80K-L protein) Length = 331 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 322 EGAAAGNGSPTPLMARVASTTSSYETPK 239 EG AA GSPT AS SS +PK Sbjct: 109 EGEAAEPGSPTAAEGEAASAASSTSSPK 136
>FAHD1_MOUSE (Q8R0F8) Fumarylacetoacetate hydrolase domain-containing protein 1| (EC 3.-.-.-) Length = 227 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 122 LIQLCTRASTKLRHLFWNEGSTICILGQRH 33 + Q CT ASTK FW G I +G+ + Sbjct: 1 MTQSCTMASTKPLSRFWEWGKNIVCVGRNY 30
>DOCK2_HUMAN (Q92608) Dedicator of cytokinesis protein 2| Length = 1830 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = -3 Query: 223 VVHGTLVVFRPK*MSQILYD*ISTLPVLK*LSKA*YNFVLELVQS 89 V+H +VF K +SQ+LY+ + +P +K L K + E+VQS Sbjct: 802 VLHDVEMVFDAKLLSQLLYEFYTCIPPVK-LQKQKVQSMNEIVQS 845
>SECB_PSEPK (Q88CX7) Protein-export protein secB| Length = 161 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 331 RQCEGAAAGNGSPTPLMARVASTTSSYETPK*PQ 230 +Q GAAA + SP + R+ S+E PK PQ Sbjct: 4 QQTNGAAAEDNSPQFSLQRIYVRDLSFEAPKSPQ 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,925,912 Number of Sequences: 219361 Number of extensions: 748521 Number of successful extensions: 1922 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1922 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)