Clone Name | rbastl56a03 |
---|---|
Clone Library Name | barley_pub |
>YJ13_SCHPO (O13681) Hypothetical protein C737.03c in chromosome III| Length = 615 Score = 31.2 bits (69), Expect = 0.63 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +1 Query: 52 LKPHAADDSTICYYCESNKEKLVAAQLTWFDQKGM*HNLQCATTSICRSNYYVD 213 LK D + C+YC KEK+ TW T SIC + ++D Sbjct: 18 LKSTFGDKTVTCFYCNKKKEKIRDGTSTW-------------TCSICEATNHID 58
>GPR81_HUMAN (Q9BXC0) Probable G-protein coupled receptor 81 (G-protein coupled| receptor 104) Length = 346 Score = 29.6 bits (65), Expect = 1.8 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 2/77 (2%) Frame = -1 Query: 334 SLGSNCPVCSCSYHIRAGLESVVLRESLSIFFILLLACKPSPRSSCFCIYL*WHTAD--C 161 +LG+ +C +H++ S V +L++ LL+ C P R+ + W D C Sbjct: 30 ALGNGVALCGFCFHMKTWKPSTVYLFNLAVADFLLMICLPF-RTDYYLRRRHWAFGDIPC 88 Query: 160 ATSLFGQTMSTVQQLVF 110 LF M+ +VF Sbjct: 89 RVGLFTLAMNRAGSIVF 105
>GPR81_MOUSE (Q8C131) Probable G-protein coupled receptor 81| Length = 343 Score = 29.6 bits (65), Expect = 1.8 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 3/101 (2%) Frame = -1 Query: 334 SLGSNCPVCSCSYHIRAGLESVVLRESLSIFFILLLACKPSPRSSCFCIYL*WHTAD--C 161 +LG+ +C +H++ S + +L++ LL+ C P R+ + W D C Sbjct: 30 ALGNGIALCGFCFHMKTWKSSTIYLFNLAVADFLLMICLPL-RTDYYLRRRHWIFGDIAC 88 Query: 160 ATSLFGQTMSTVQQLVFPCYFHSSSIL-YCHQQHVVSVYSN 41 LF M+ +VF H H+V+ SN Sbjct: 89 RLVLFKLAMNRAGSIVFLTVVAVDRYFKVVHPHHMVNAISN 129
>CAR2_DICDI (P34907) Cyclic AMP receptor 2 (cAMP receptor 2)| Length = 375 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 9/38 (23%) Frame = -1 Query: 163 CATSLFGQTMSTVQQLV---------FPCYFHSSSILY 77 CATSLF +ST+ L+ FPCY H+ I + Sbjct: 50 CATSLFKDVISTIITLLYKPDQTESGFPCYLHAIVITF 87
>S6A11_RAT (P31647) Sodium- and chloride-dependent GABA transporter 3| Length = 627 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/80 (27%), Positives = 33/80 (41%) Frame = -1 Query: 328 GSNCPVCSCSYHIRAGLESVVLRESLSIFFILLLACKPSPRSSCFCIYL*WHTADCATSL 149 G C C G + V+ L++++I++LA S+CF L W A C Sbjct: 113 GITCWRRVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPW--ATCGHEW 170 Query: 148 FGQTMSTVQQLVFPCYFHSS 89 + Q+L F Y H S Sbjct: 171 NTEKCVEFQKLNFSNYSHVS 190
>S6A11_MOUSE (P31650) Sodium- and chloride-dependent GABA transporter 4 (GAT4)| Length = 627 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/80 (27%), Positives = 33/80 (41%) Frame = -1 Query: 328 GSNCPVCSCSYHIRAGLESVVLRESLSIFFILLLACKPSPRSSCFCIYL*WHTADCATSL 149 G C C G + V+ L++++I++LA S+CF L W A C Sbjct: 113 GITCWRRVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPW--ATCGHEW 170 Query: 148 FGQTMSTVQQLVFPCYFHSS 89 + Q+L F Y H S Sbjct: 171 NTEKCVEFQKLNFSNYSHVS 190
>CALI_BOVIN (Q28068) Calicin| Length = 588 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 139 TMSTVQQLVFPCYFHSSSILYCHQQHVVSVYSN 41 T VQ + FP F+ +L HQ +++ VYS+ Sbjct: 452 TGEVVQCITFPIEFNHRPLLSFHQDNILCVYSH 484
>SBCC_CLOAB (Q97FK1) Nuclease sbcCD subunit C| Length = 1163 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 328 GSNCPVCSCSYHIRAGLESVVLR 260 G CPVC +HI+ G + V L+ Sbjct: 573 GEACPVCGSVHHIKEGFKEVDLK 595 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,817,436 Number of Sequences: 219361 Number of extensions: 861600 Number of successful extensions: 2399 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2399 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)