Clone Name | rbastl55g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | REN3A_HUMAN (Q9H1J1) Regulator of nonsense transcripts 3A (Nonse... | 28 | 4.9 | 2 | KIF17_MOUSE (Q99PW8) Kinesin-like protein KIF17 (MmKIF17) | 28 | 6.4 |
---|
>REN3A_HUMAN (Q9H1J1) Regulator of nonsense transcripts 3A (Nonsense mRNA| reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3) Length = 476 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = +1 Query: 4 SIDCNPRYYMF----CLYKEKTQSTKDTDLIELRGKTRYIV 114 SI+ +P Y F C+ +EKT + +T L E+ KTR ++ Sbjct: 170 SIEDDPEYKKFLETYCVEEEKTSANPETLLGEMEAKTRELI 210
>KIF17_MOUSE (Q99PW8) Kinesin-like protein KIF17 (MmKIF17)| Length = 1038 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 147 REAIFMPLEEENYIPCFSPKLNKVCVLCGLRFFFVEAEHIIPRIA 13 +EA PLE E Y+ P L + +L L+ F E E + R++ Sbjct: 585 QEAAASPLEAERYVQENEPSLEPLRILASLQDPFAEVEAKLARLS 629 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,636,645 Number of Sequences: 219361 Number of extensions: 450956 Number of successful extensions: 1265 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)