Clone Name | rbastl55f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VIRB6_AGRT5 (P17796) Protein virB6 | 28 | 8.5 |
---|
>VIRB6_AGRT5 (P17796) Protein virB6| Length = 295 Score = 27.7 bits (60), Expect = 8.5 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -2 Query: 179 LPLWPIPVQMSTIV*L----HAHTSSEIGQFASKFTLRFMGCEMSFGGSLVS 36 LPL IP Q+ T+ L +SEIG + L F G + F G+L S Sbjct: 108 LPLQTIPAQLDTMFALTQAAFQRIASEIGPMNDQDILAFQGAQWVFYGTLWS 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,967,034 Number of Sequences: 219361 Number of extensions: 589477 Number of successful extensions: 1261 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1261 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)