| Clone Name | rbastl55f10 |
|---|---|
| Clone Library Name | barley_pub |
>MASS1_HUMAN (Q8WXG9) Monogenic audiogenic seizure susceptibility protein 1| homolog precursor (Very large G-protein coupled receptor 1) (Usher syndrome type-2C protein) (G-protein coupled receptor 98) Length = 6307 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +2 Query: 74 LQDDESLDLFFWQMNQSTLKTYKILEIRAKQIARMH 181 L D S+D+F W+M QS+ + ++ ++ A + R+H Sbjct: 3475 LGDQNSIDIFIWEMGQSSFRYFQSVDFAA--VNRIH 3508
>L_SENDZ (P06447) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 226 VINEDTKHHGSSWVPCDYP 282 +IN + HG W PCD+P Sbjct: 404 IINGYRERHGGQWPPCDFP 422
>L_SENDO (O55528) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 226 VINEDTKHHGSSWVPCDYP 282 +IN + HG W PCD+P Sbjct: 404 IINGYRERHGGQWPPCDFP 422
>L_SENDF (Q06996) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 226 VINEDTKHHGSSWVPCDYP 282 +IN + HG W PCD+P Sbjct: 404 IINGYRERHGGQWPPCDFP 422
>L_SENDE (P06829) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 226 VINEDTKHHGSSWVPCDYP 282 +IN + HG W PCD+P Sbjct: 404 IINGYRERHGGQWPPCDFP 422
>L_SENDA (Q9DUD8) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 226 VINEDTKHHGSSWVPCDYP 282 +IN + HG W PCD+P Sbjct: 404 IINGYRERHGGQWPPCDFP 422
>CHRD_XENLA (Q91713) Chordin precursor (Organizer-specific secreted dorsalizing| factor) Length = 941 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 250 HGSSWVPCDYPPKRKGATN*PHFKALIC--ICNPSITCPQPINLP 378 HGS W P DY RK + + +IC I P + C QP++LP Sbjct: 702 HGSRWAP-DYD--RKCSVCSCQKRTVICDPIVCPPLNCSQPVHLP 743
>CDC16_SCHPO (P36618) Cell division control protein 16| Length = 299 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 101 RGQVIHHPANCTIMRGFPKLKSQTCRTTQLLLL 3 R Q+I HP+ T++R FP L ++ +LL+ Sbjct: 239 REQLIDHPSPMTLLRTFPPLNAKNIMKITILLI 271
>NLE1_PONPY (Q5RFF8) Notchless homolog 1| Length = 484 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 122 STLKTYKILEIRAKQIARMHLHGHSNKAGPNNWAPSSMRTRS 247 S+ T K+ +++A+++A M L GH+++ +W+P R S Sbjct: 432 SSDSTLKVWDVKAQKLA-MDLPGHADEVYAVDWSPDGQRVAS 472
>NLE1_HUMAN (Q9NVX2) Notchless homolog 1| Length = 484 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 122 STLKTYKILEIRAKQIARMHLHGHSNKAGPNNWAPSSMRTRS 247 S+ T K+ +++A+++A M L GH+++ +W+P R S Sbjct: 432 SSDSTLKVWDVKAQKLA-MDLPGHADEVYAVDWSPDGQRVAS 472
>YAA4_SCHPO (Q09798) Hypothetical protein C22G7.04 in chromosome I| Length = 1115 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 188 GHSNKAGPNNWAPSSMRTRSITGHHGSHVTILPKEKG--QLINHTLRL 325 GH N +++ PS GH G +LP+E+G L + +LRL Sbjct: 36 GHKNGQIKSSFGPSLTSYTQFIGHEGPVHQVLPQERGVFSLSSKSLRL 83
>TRI22_HUMAN (Q8IYM9) Tripartite motif protein 22 (RING finger protein 94) (50| kDa-stimulated trans-acting factor) (Staf-50) Length = 498 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 221 APSSMRTRSITGHHGSHVTILPKEKGQLINHTLRL*FAFATHQSHALNQ 367 +P + R + HHG + I KE G++I L HQ+ +N+ Sbjct: 87 SPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINE 135
>PMP1_SCHPO (O13453) Tyrosine-protein phosphatase pmp1 (EC 3.1.3.48)| Length = 278 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 232 NEDTKHHGSSWVPCDYPPK----RKGATN*PHFKALICICNPSI 351 NE+ H + PC PP K +N P+ +CI P+I Sbjct: 26 NEEEASHSQLFTPCPVPPSFPKASKPNSNQPYPNGPVCIYPPNI 69
>ALR1_YEAST (Q08269) Magnesium transporter ALR1 (Aluminum resistance protein 1)| Length = 859 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 143 ILEIRAKQIARMHLHGHSNKAGPNNWAPSSMRTR 244 I ++A+Q H+ +S+ PNN+AP++ + R Sbjct: 653 IANLQARQDNASHIKNNSSTTVPNNYAPTTSQPR 686 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,528,106 Number of Sequences: 219361 Number of extensions: 1108493 Number of successful extensions: 2173 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2172 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)