Clone Name | rbastl55f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | STAG3_MOUSE (O70576) Cohesin subunit SA-3 (Stromal antigen 3) (S... | 30 | 3.5 | 2 | STAG3_RAT (Q99M76) Cohesin subunit SA-3 (Stromal antigen 3) (Str... | 30 | 3.5 |
---|
>STAG3_MOUSE (O70576) Cohesin subunit SA-3 (Stromal antigen 3) (Stromalin 3)| (SCC3 homolog 3) Length = 1240 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 202 AFF*IHNTTQYPICEPCARIFNHLLKHAKQTSRVTH 309 AF+ H+ T++ I EPC+R LL+ A T V H Sbjct: 723 AFYNAHDLTRWEISEPCSR----LLRKAVDTGEVPH 754
>STAG3_RAT (Q99M76) Cohesin subunit SA-3 (Stromal antigen 3) (Stromalin 3)| (SCC3 homolog 3) Length = 1256 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 202 AFF*IHNTTQYPICEPCARIFNHLLKHAKQTSRVTH 309 AF+ H+ T++ I EPC+R LL+ A T V H Sbjct: 723 AFYNAHDLTRWEISEPCSR----LLRKAVDTGEVPH 754 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,558,916 Number of Sequences: 219361 Number of extensions: 847633 Number of successful extensions: 1916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1915 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)