Clone Name | rbastl55e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRPC_BUCSC (Q44603) Tryptophan biosynthesis protein trpCF [Inclu... | 30 | 1.7 |
---|
>TRPC_BUCSC (Q44603) Tryptophan biosynthesis protein trpCF [Includes:| Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS); N-(5'-phospho-ribosyl)anthranilate isomerase (EC 5.3.1.24) (PRAI)] Length = 461 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -2 Query: 147 VDPVQVYSMNEHQVRSINLLLLSVRKYSFYLTITRIIYNL 28 +DP Q+Y +Q SI LL+LS+ K + Y + ++ Y+L Sbjct: 120 IDPYQIYLARYYQADSI-LLMLSILKDNQYRALEKLAYSL 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,657,598 Number of Sequences: 219361 Number of extensions: 385557 Number of successful extensions: 635 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)