>CT054_HUMAN (Q9NQ40) Protein C20orf54 precursor|
          Length = 469

 Score = 28.9 bits (63), Expect = 3.8
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 4/71 (5%)
 Frame = -2

Query: 204 GCKRLFVCRWILFGGCKGAICYTKYIGQSRVSLGTLSRSRM*TSDC*TQLSDVAGALYL- 28
           G + L V  W+LF GC   + Y K +    V L  LSRS +       QL  + GAL + 
Sbjct: 394 GGEVLIVASWVLFSGC---LSYVKVM--LGVVLRDLSRSALLWCGAAVQLGSLLGALLMF 448

Query: 27  ---HCTSLFSS 4
              +   LFSS
Sbjct: 449 PLVNVLRLFSS 459


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,597,000
Number of Sequences: 219361
Number of extensions: 698732
Number of successful extensions: 1660
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1645
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1660
length of database: 80,573,946
effective HSP length: 50
effective length of database: 69,605,896
effective search space used: 1670541504
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)