Clone Name | rbastl55e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CT054_HUMAN (Q9NQ40) Protein C20orf54 precursor | 29 | 3.8 |
---|
>CT054_HUMAN (Q9NQ40) Protein C20orf54 precursor| Length = 469 Score = 28.9 bits (63), Expect = 3.8 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = -2 Query: 204 GCKRLFVCRWILFGGCKGAICYTKYIGQSRVSLGTLSRSRM*TSDC*TQLSDVAGALYL- 28 G + L V W+LF GC + Y K + V L LSRS + QL + GAL + Sbjct: 394 GGEVLIVASWVLFSGC---LSYVKVM--LGVVLRDLSRSALLWCGAAVQLGSLLGALLMF 448 Query: 27 ---HCTSLFSS 4 + LFSS Sbjct: 449 PLVNVLRLFSS 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,597,000 Number of Sequences: 219361 Number of extensions: 698732 Number of successful extensions: 1660 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1660 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)