Clone Name | rbastl55d02 |
---|---|
Clone Library Name | barley_pub |
>SEM1A_DROME (Q24322) Semaphorin-1A precursor (Semaphorin-I) (Sema I)| Length = 850 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -2 Query: 344 LCWRGPKQSI*QKWMIKQDEPQSHKFCKFKILPQAGELTPFGSNFFREVC 195 L W P+ + +DE + + ++P G L G+N FR +C Sbjct: 80 LVWTSPEDDTKMCLVKGKDEEACQNYIRIMVVPSPGRLFVCGTNSFRPMC 129
>CNTN2_HUMAN (Q02246) Contactin-2 precursor (Axonin-1) (Axonal glycoprotein| TAG-1) (Transient axonal glycoprotein 1) (TAX-1) Length = 1040 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 11/45 (24%) Frame = +2 Query: 101 TKCSLQTTGFILCFTNNKN-SLSANA----------FRLNPVRRL 202 +K SL+ +G C NK+ ++ A+A FRLNPVRRL Sbjct: 383 SKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRL 427
>YA4G_SCHPO (Q09733) Hypothetical protein C31A2.16 in chromosome I| Length = 1101 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 379 PSRLLLGLVRTYSAGGALXXXXXXXXXXNKMNHNHINSANSKF 251 PS++ L L R Y+ GG ++HN+I+ + KF Sbjct: 737 PSKISLSLNRFYNQGGLSKSCATLPSQMYNLDHNNISQKSLKF 779
>TPO_MOUSE (P40226) Thrombopoietin precursor (Megakaryocyte colony-stimulating| factor) (Myeloproliferative leukemia virus oncogene ligand) (C-mpl ligand) (ML) (Megakaryocyte growth and development factor) (MGDF) Length = 356 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 9 KSSLALFSSFIQEVETASPGLLSNLLSYKI*LNAAYRQQVSSFVLQIT 152 ++S L ++F TA PGLLS L +++ + Q S +QI+ Sbjct: 198 RTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQIS 245
>TPP2_HUMAN (P29144) Tripeptidyl-peptidase 2 (EC 3.4.14.10)| (Tripeptidyl-peptidase II) (TPP-II) (Tripeptidyl aminopeptidase) Length = 1248 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 302 MIKQDEPQSHKFCKFKILPQAGELT 228 ++KQ +SH+F KF LP+ G LT Sbjct: 694 LVKQRAYRSHEFYKFCSLPEKGTLT 718 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,815,634 Number of Sequences: 219361 Number of extensions: 918108 Number of successful extensions: 1609 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1609 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)