>RFCL_METTH (O26342) Replication factor C large subunit (RFC large subunit)|
(Clamp loader large subunit) (mthRFC large subunit)
Length = 479
Score = 27.7 bits (60), Expect = 7.6
Identities = 17/52 (32%), Positives = 25/52 (48%)
Frame = +2
Query: 92 QKDLVENLVDNRFCLLALRKGKDRPKLTRSNRRISDPFLSIPFRGTGVARDY 247
+KD NL D + A+ K +D K+ + R DP L + F V R+Y
Sbjct: 220 EKDATSNLFD---AVRAVLKSRDVSKVREAMRVDDDPTLVLEFIAENVPREY 268
Database: uniprot_sprot.fasta
Posted date: May 25, 2006 5:36 PM
Number of letters in database: 80,573,946
Number of sequences in database: 219,361
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,836,096
Number of Sequences: 219361
Number of extensions: 577914
Number of successful extensions: 1460
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1460
length of database: 80,573,946
effective HSP length: 80
effective length of database: 63,025,066
effective search space used: 1512601584
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)