Clone Name | rbastl55c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosp... | 28 | 8.9 |
---|
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 8.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 3 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 143 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,624,163 Number of Sequences: 219361 Number of extensions: 374098 Number of successful extensions: 983 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)