Clone Name | rbastl55b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxyla... | 28 | 6.2 | 2 | GNL3_XENTR (Q6P4W5) Guanine nucleotide-binding protein-like 3 (N... | 28 | 8.1 |
---|
>GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 492 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 230 LQPFGE*SLRMCGTARVRNG--LRSIFSVHNFVPVIAFCLHPFVLLGAKVKQAVLR 69 ++ G LR A V N +++ H +P +C H FVL G+K K+ +R Sbjct: 342 IRTMGAEGLREVSEAAVLNANYIKASLKDHYEIPYEQYCKHEFVLSGSKQKEHGVR 397
>GNL3_XENTR (Q6P4W5) Guanine nucleotide-binding protein-like 3| (Nucleostemin-like protein) Length = 548 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 58 DVPSRRTACFTLAPSKTKGCKQKAMTGTKLCTE 156 ++P+ C APSK+ G K K LCTE Sbjct: 192 ELPTVPFRCLPQAPSKSPGKKHKVPNTADLCTE 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,308,787 Number of Sequences: 219361 Number of extensions: 671435 Number of successful extensions: 1514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1514 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)