| Clone Name | rbastl55b01 |
|---|---|
| Clone Library Name | barley_pub |
>CLUS_PIG (Q29549) Clusterin precursor (Complement cytolysis inhibitor) (CLI)| (CP40) [Contains: Clusterin beta chain; Clusterin alpha chain] Length = 446 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 8 KFPLNLIPSQKFTNTNYHGFFSMFFE*LFYLQVQITA 118 +F N++P FT+ NYH F FF+ + Q + A Sbjct: 224 RFARNIMPFPLFTDLNYHDMFQPFFDMIHQAQQAMDA 260
>NMT_AJECA (P34763) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 529 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 43 YKHELPWFLLHVL*MTILPAGTNNSTVLAPNSLLHNTSTP 162 Y L W LH + + LP G+ S + N L +TSTP Sbjct: 301 YHRALDWLKLHEVGFSPLPIGSTKSRQVTRNHLPGHTSTP 340
>NMT_ASPFU (Q9UVX3) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 492 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 43 YKHELPWFLLHVL*MTILPAGTNNSTVLAPNSLLHNTSTP 162 Y L W L+ + + LPAG+ + + N L TSTP Sbjct: 264 YHRPLDWLKLYEVGFSPLPAGSTKARQITKNHLPSTTSTP 303
>COX2_ORYSA (P04373) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 260 Score = 27.7 bits (60), Expect = 7.1 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 1 DQEISIKSYTISEVYKHELPWFLLHVL*MTILPAGTNNSTVLAPNSLLHNTSTPYS 168 +Q ++ SYTI E LL V ++PA T+ ++ P +LH+ + P S Sbjct: 141 EQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPADVLHSWAVPSS 196
>FZD7_MOUSE (Q61090) Frizzled 7 precursor (Frizzled-7) (Fz-7) (mFz7)| Length = 572 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 127 LIRCCYLYLQVK*SFKEHGEETMVVRVCK 41 ++ CY Y Q +F+EH E T +++ CK Sbjct: 482 IVLACYFYEQ---AFREHWERTWLLQTCK 507
>FZD7_HUMAN (O75084) Frizzled 7 precursor (Frizzled-7) (Fz-7) (hFz7) (FzE3)| Length = 574 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 127 LIRCCYLYLQVK*SFKEHGEETMVVRVCK 41 ++ CY Y Q +F+EH E T +++ CK Sbjct: 484 IVLACYFYEQ---AFREHWERTWLLQTCK 509
>NMT_EMENI (Q8TFN1) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 492 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 43 YKHELPWFLLHVL*MTILPAGTNNSTVLAPNSLLHNTSTP 162 Y L W L+ + + LP G+ + + N L +TSTP Sbjct: 264 YHRPLDWLKLYEVGFSPLPRGSTKARQITKNHLPSHTSTP 303
>MURG_STRPN (Q9ZHA9) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 352 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 301 LQKLLSPPNVDGGWTASYAGNSCG 372 L LL P ++ GW Y G+ CG Sbjct: 17 LNLLLMPKFIEDGWEVHYIGDKCG 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,675,231 Number of Sequences: 219361 Number of extensions: 994813 Number of successful extensions: 1967 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1967 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)