Clone Name | rbastl55a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TMOE_PSEME (Q00460) Toluene-4-monooxygenase system protein E (EC... | 28 | 6.1 | 2 | ATS20_HUMAN (P59510) ADAMTS-20 precursor (EC 3.4.24.-) (A disint... | 28 | 7.9 |
---|
>TMOE_PSEME (Q00460) Toluene-4-monooxygenase system protein E (EC 1.14.13.-)| Length = 326 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 10 TICPLLINETIVQKSQHSRWKQQLCQSGLSS 102 T+ PLLI+ + +HSRW + L + L + Sbjct: 244 TLLPLLIDSQLKDAERHSRWSKALVKHALEN 274
>ATS20_HUMAN (P59510) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1911 Score = 27.7 bits (60), Expect = 7.9 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = -2 Query: 254 EMGVQGPRMVMMVDGSGN*SAQTSYGQNSCSRS---------CVDELYDEDLHY 120 E+ VQG R V+ GS N + NS +R CV LY+ D+HY Sbjct: 786 EINVQGTRTVIEYSGSNNAVERI----NSTNRQEKELILQVLCVGNLYNPDVHY 835 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,948,930 Number of Sequences: 219361 Number of extensions: 625932 Number of successful extensions: 1214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1214 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)