Clone Name | rbastl55a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF3X_HUMAN (O75153) Putative eukaryotic translation initiation f... | 30 | 2.4 |
---|
>IF3X_HUMAN (O75153) Putative eukaryotic translation initiation factor 3| subunit (eIF-3) Length = 1309 Score = 29.6 bits (65), Expect = 2.4 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 5 ELWPAIDCKNKFQLIHSNARHYLADSFQTFMFDSRPLPEP 124 EL +++CK +I ++ RHY+ D +TF D LP P Sbjct: 544 ELCSSVECKG---IIGNDGRHYILDLLRTFPPDLNFLPVP 580 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,082,665 Number of Sequences: 219361 Number of extensions: 249780 Number of successful extensions: 659 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)