ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl54h10 |
|---|---|
| Clone Library Name | barley_pub |
>GCS1_HUMAN (Q13724) Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106)| (Processing A-glucosidase I) Length = 837 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 255 PTSPEAHHICSPGEGLKMAPFFWQFH 332 P +P+ H C G+G + P+ W+FH Sbjct: 128 PGTPKLRHTCEQGDG--VGPYGWEFH 151
>GCSP_RALEJ (Q46VZ5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 976 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 1 PSSLTFRFIMTSHYNPSTANLCHTNAYITDAIIN 102 P+SLTF I + + ANL T+AY+T + N Sbjct: 461 PASLTFDAIEAAAEDAFPANLARTSAYLTHPVFN 494
>MYCL1_HUMAN (P12524) L-myc-1 proto-oncogene protein| Length = 364 Score = 29.3 bits (64), Expect = 2.5 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +2 Query: 68 IQMLT*QMRSSTTYQKYETPVKFMYMFYLLDICIRHIFTSFKMQQHNSGLLCPLRSWQEL 247 I ++T + R S +K PV LD C++H S QQHN P S + Sbjct: 170 IDVVTVEKRQSLGIRK---PVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQE 226 Query: 248 QAS 256 +AS Sbjct: 227 EAS 229
>GCS1_RAT (O88941) Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106)| (Glycoprotein-processing glucosidase I) Length = 834 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 258 TSPEAHHICSPGEGLKMAPFFWQFH 332 T P+ H C G+G + P+ W+FH Sbjct: 128 TPPKLRHTCEQGDG--VGPYGWEFH 150
>GCS1_MOUSE (Q80UM7) Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106)| (Glycoprotein-processing glucosidase I) (Glucosidase 1) Length = 834 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 258 TSPEAHHICSPGEGLKMAPFFWQFH 332 T P+ H C G+G + P+ W+FH Sbjct: 128 TPPKLRHTCEQGDG--VGPYGWEFH 150
>HEMA_INBLE (P03460) Hemagglutinin precursor [Contains: Hemagglutinin HA1| chain; Hemagglutinin HA2 chain] Length = 584 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 210 LAYFVPSDLGKSSRLPTSPEAHHICSPGEGLKMAPFFWQFH 332 +A+ +P D K++ P + E +ICS GE W FH Sbjct: 171 MAWVIPKDNNKTAINPVTVEVPYICSEGEDQITV---WGFH 208
>TOLB_XANOR (Q5H299) Protein tolB precursor| Length = 439 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 211 WPTLSPQILARAPGFQPPLKHTIFAAQ--GRG 300 W TLSP L +P F P ++AA+ GRG Sbjct: 374 WSTLSPGSLDESPSFAPNASMVLYAAREGGRG 405
>TOLB_XANCP (Q8P6F2) Protein tolB precursor| Length = 439 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 211 WPTLSPQILARAPGFQPPLKHTIFAAQ--GRG 300 W TLSP L +P F P ++AA+ GRG Sbjct: 374 WSTLSPGSLDESPSFAPNASMVLYAAREGGRG 405
>TOLB_XANAC (Q8PHV7) Protein tolB precursor| Length = 439 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 211 WPTLSPQILARAPGFQPPLKHTIFAAQ--GRG 300 W TLSP L +P F P ++AA+ GRG Sbjct: 374 WSTLSPGSLDESPSFAPNASMVLYAAREGGRG 405
>FOXN1_MOUSE (Q61575) Forkhead box protein N1 (Transcription factor winged-helix| nude) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HNF-3/forkhead homolog 11) (HFH-11) Length = 648 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 7/50 (14%) Frame = +1 Query: 220 LSPQILARAPG---FQPPLKHTIFAAQGRG*RWLPFSGS----FIGCPYH 348 + PQ L PG +QPPL+H ++Q ++ P GS ++G P++ Sbjct: 202 VKPQALDSGPGMYCYQPPLQHMYCSSQPAFHQYSPGGGSYPVPYLGSPHY 251
>GUNB_PSEFL (P18126) Endoglucanase B precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) (EGB) Length = 511 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 48 FNCKSMSYK-CLHNRCDHQQPIKSMRHP*SSCTCFTYWISA*DIFSLPSK 194 +N YK C+ NRCD + + CT F W A D SL K Sbjct: 435 YNASLSQYKSCVLNRCDSVFGSRGLTQLQQGCTWFAEWFEAADNPSLKYK 484
>HABP2_MOUSE (Q8K0D2) Hyaluronan-binding protein 2 precursor (EC 3.4.21.-)| (Plasma hyaluronan-binding protein) [Contains: Hyaluronan-binding protein 2 50 kDa heavy chain; Hyaluronan-binding protein 2 50 kDa heavy chain alternate form; Hyaluronan-binding p Length = 558 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 54 CKSMSYKCLHNRCDHQQPIKSMRHP*SSCTC 146 C++ KC N C H + + +HP C C Sbjct: 106 CQTAQNKCKDNPCVHGDCLITQKHPYYRCAC 136
>FBX24_HUMAN (O75426) F-box only protein 24| Length = 580 Score = 27.7 bits (60), Expect = 7.3 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -2 Query: 291 LGCKYGVLQGRLEAW--SSCQDLRGQSRPELCCCILKEVKICLMQISS 154 LGC G GRL W S ++ Q + LC C L + CL +SS Sbjct: 433 LGCGCGA-GGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSS 479
>NUDEL_DROME (P98159) Serine protease nudel precursor (EC 3.4.21.-)| Length = 2616 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 66 SYKCLHNR--CDHQQPIKSMRHP*SSCTCFTY 155 S+KC+ CDH + M + C+CFTY Sbjct: 2361 SFKCVPKSKFCDHVPDCEDMTDEPTICSCFTY 2392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,747,329 Number of Sequences: 219361 Number of extensions: 1053149 Number of successful extensions: 2257 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2257 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
