Clone Name | rbastl54h06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OPT6_ARATH (Q9T095) Oligopeptide transporter 6 (AtOPT6) | 28 | 6.5 |
---|
>OPT6_ARATH (Q9T095) Oligopeptide transporter 6 (AtOPT6)| Length = 736 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 148 LVTVVILLSVYCWLNPS--LIEQLGCG*AGYRI 56 L T++ +S CWLNP L+ QLG G G I Sbjct: 228 LFTMLTSISWVCWLNPKSILVNQLGSGEHGLGI 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,392,013 Number of Sequences: 219361 Number of extensions: 430685 Number of successful extensions: 934 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 934 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)