Clone Name | rbastl54g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FSHR_FELCA (Q5GJ04) Follicle-stimulating hormone receptor precur... | 29 | 2.5 | 2 | PAFA_CAEEL (Q22943) Platelet-activating factor acetylhydrolase h... | 28 | 4.3 | 3 | PCY1_YEAST (P13259) Choline-phosphate cytidylyltransferase (EC 2... | 28 | 5.6 | 4 | HTPX2_SULAC (Q4JBJ9) Probable protease htpX homolog 2 (EC 3.4.24.-) | 28 | 5.6 |
---|
>FSHR_FELCA (Q5GJ04) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 695 Score = 29.3 bits (64), Expect = 2.5 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 319 LSLFHVMSLF*YMNYNLAPCGILLICCCDSHL-LPVSKPHLVAGCLESKI 173 LS +VMSL L ++ICCC +H+ L V P++V+ ++KI Sbjct: 526 LSQLYVMSLL-----VLNVLAFVVICCCYAHIYLTVRNPNIVSSSSDTKI 570
>PAFA_CAEEL (Q22943) Platelet-activating factor acetylhydrolase homolog 2 (EC| 3.1.1.47) Length = 388 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = +1 Query: 172 QFLTPNTQQPNVVSTLAVGDYRSSR*AKSHMAQDCSSYTRIKTLHGKGRAHKGY 333 ++L ++Q+ NV+++ VG+ R + M+ C + + HG G + Y Sbjct: 71 EYLGQSSQKMNVITSTVVGEKREDCIENAQMSTKCDKWPIVVFSHGLGGSRTFY 124
>PCY1_YEAST (P13259) Choline-phosphate cytidylyltransferase (EC 2.7.7.15)| (Phosphorylcholine transferase) (CTP:phosphocholine cytidylyltransferase) (CT) (CCT) Length = 424 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 27 KLRKYAPQGYKYMIQCGDDTIRMQLDALF 113 +LRKY P+G+++ + D IR+ D +F Sbjct: 84 ELRKYRPKGFRFNLPPTDRPIRIYADGVF 112
>HTPX2_SULAC (Q4JBJ9) Probable protease htpX homolog 2 (EC 3.4.24.-)| Length = 320 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 37 NMRHRDTST*SSVEMIPSECNWMPYSV 117 ++RHRDT +V +IP+ W+ YS+ Sbjct: 139 HLRHRDTEILLAVSLIPTLMYWLGYSL 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,808,644 Number of Sequences: 219361 Number of extensions: 1115947 Number of successful extensions: 2154 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2151 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)