Clone Name | rbastl54g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TES_MOUSE (P47226) Testin (TES1/TES2) | 29 | 3.3 | 2 | VE6_HPV45 (P21735) Protein E6 | 28 | 7.3 | 3 | VE1_HPV08 (P06420) Replication protein E1 (EC 3.6.1.-) (ATP-depe... | 27 | 9.5 | 4 | MKT1_YEAST (P40850) Protein MKT1 | 27 | 9.5 | 5 | THI1_SCHPO (P36598) Thiamine repressible genes regulatory protei... | 27 | 9.5 | 6 | DALY_DROME (Q24114) Division abnormally delayed protein precurso... | 27 | 9.5 |
---|
>TES_MOUSE (P47226) Testin (TES1/TES2)| Length = 423 Score = 28.9 bits (63), Expect = 3.3 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = +1 Query: 112 RMDPGTMP*RKKGECTNVTIHLYICCSY---EGEL*LWAVRLRLDHFHMDHNTLQHSIAY 282 R P + + K + T + CC + EGE ++A R D L H + Sbjct: 216 RHAPAAVASKDKSAESKKTQYSCYCCKHTTNEGEPAIYAERAGYDK-------LWHPACF 268 Query: 283 VCSRLGYFLVHLVYY 327 +CS G LV ++Y+ Sbjct: 269 ICSTCGELLVDMIYF 283
>VE6_HPV45 (P21735) Protein E6| Length = 158 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 6/36 (16%) Frame = -2 Query: 129 CTRVHSSIQQILVIL*YCQISLE------FLFTELC 40 CT +++S+Q + + YC+ +LE F F +LC Sbjct: 18 CTELNTSLQDVSIACVYCKATLERTEVYQFAFKDLC 53
>VE1_HPV08 (P06420) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 603 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 14 FLASIKRFLHSSVKRNSRLI 73 FLA++K FLHS KRN LI Sbjct: 410 FLAALKDFLHSVPKRNCLLI 429
>MKT1_YEAST (P40850) Protein MKT1| Length = 830 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 253 HNTLQHSIAYVCSRLGYFLVHLVYYPVSPFVS 348 HNT S AY + YF+ H Y V+P+ S Sbjct: 161 HNTTIDSKAYQNDLIAYFIEHGYMYQVAPYSS 192
>THI1_SCHPO (P36598) Thiamine repressible genes regulatory protein thi1| (Transcription factor ntf1) Length = 775 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 75 QISLEFLFTELCKNLFIDAKNL 10 Q+ LE++F+ +C N ++ KNL Sbjct: 88 QLCLEYIFSRMCPNFNLETKNL 109
>DALY_DROME (Q24114) Division abnormally delayed protein precursor (Dally| protein) Length = 626 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 286 KHKLCCAAECYDPYGSGRASASPPKATAHPHMNN 185 K K C PY SG A PP PH NN Sbjct: 401 KVKKTCGTPSLTPYSSGEPDARPP-----PHKNN 429 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,731,523 Number of Sequences: 219361 Number of extensions: 960631 Number of successful extensions: 2173 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2173 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)