Clone Name | rbastl54g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | XRCC3_MOUSE (Q9CXE6) DNA-repair protein XRCC3 (X-ray repair cros... | 30 | 1.1 | 2 | YQBB_BACSU (P45918) Hypothetical protein yqbB | 28 | 4.3 | 3 | GATB_BOMMO (P52167) Transcription factor BCFI (GATA-beta) (BmGAT... | 27 | 9.6 |
---|
>XRCC3_MOUSE (Q9CXE6) DNA-repair protein XRCC3 (X-ray repair cross-complementing| protein 3) Length = 349 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 147 LHPSVALRWAGRLIEREHAGRVHSDD-NFFLHRLVARVVIFRYLPALP--ACC 296 L P++ + WA +L+ R R H DD L R R + + P LP +CC Sbjct: 280 LSPALGITWANQLLMRLMVDRTHEDDVTTGLPRSPVRTLRVLFAPHLPLSSCC 332
>YQBB_BACSU (P45918) Hypothetical protein yqbB| Length = 305 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 248 RSSCHLPLSPCVAGLLLGVEKEQVHELELEL 340 R +CH LSP V +LG+ E+ E++ E+ Sbjct: 270 RVNCHCVLSPVVDSKILGLSPEEKEEIQREV 300
>GATB_BOMMO (P52167) Transcription factor BCFI (GATA-beta) (BmGATA-beta)| Length = 508 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 256 TRATSLWRKKLSSEWTLPACSLSINL 179 T ATSLWR+ + E AC L L Sbjct: 327 TTATSLWRRNVQGETVCNACGLYFKL 352 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,815,420 Number of Sequences: 219361 Number of extensions: 839901 Number of successful extensions: 2542 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2538 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)