ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl54g05 |
|---|---|
| Clone Library Name | barley_pub |
>PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, subtype EP4) Length = 488 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +3 Query: 189 QHSSDS--TYLQIDTHTHIFFRRGLRLTEVALTCFALLYLPSIS 314 QH SDS T + TH+ F R L+ E++ T LLYLP +S Sbjct: 364 QHCSDSRRTSSAMSTHSRSFLSRELK--EISSTSQTLLYLPELS 405
>EDN1_RAT (P22388) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 268 SVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 S S RPRR K C C S+ + +EC FC Sbjct: 42 STSWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_FELCA (Q5NRQ1) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 274 ATSVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 A S RPRR K C C S+ L +EC FC Sbjct: 40 APSAPWRPRRSKRCSCSSL----LDKECVYFC 67
>EDN1_CANFA (P13206) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 274 ATSVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 A S RPRR K C C S+ + +EC FC Sbjct: 40 APSAPWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_PIG (P09558) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| [Contains: Big endothelin-1] Length = 203 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 262 SLRPRRKKMCVCVSICKYVLSEECCLFC 179 S RPRR K C C S+ + +EC FC Sbjct: 44 SWRPRRSKRCSCSSL----MDKECVYFC 67
>YEAC_SCHPO (O14077) Putative zinc-protease UNK4.12c (EC 3.4.99.-)| Length = 969 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 325 RWIDDILGKYSKAKHVRATSVSLRPRRKKMCVCVS 221 R I+D LG+YS + S SL P + + +C+S Sbjct: 560 RLIEDALGEYSYPASLAGLSFSLSPSTRGIILCIS 594
>EDN1_RABIT (P29560) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 268 SVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 S RPRR K C C S+ + +EC FC Sbjct: 42 SAPWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_MOUSE (P22387) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 268 SVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 S RPRR K C C S+ + +EC FC Sbjct: 42 STPWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_BOVIN (P17322) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 274 ATSVSLRPRRKKMCVCVSICKYVLSEECCLFC 179 A + RPRR K C C S+ + +EC FC Sbjct: 40 APATPWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_SHEEP (Q9BG76) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 256 RPRRKKMCVCVSICKYVLSEECCLFC 179 RPRR K C C S+ + +EC FC Sbjct: 46 RPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_ATEAB (Q5NRP9) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 256 RPRRKKMCVCVSICKYVLSEECCLFC 179 RPRR K C C S+ + +EC FC Sbjct: 46 RPRRSKRCSCSSL----MDKECVYFC 67
>FABH_PORUM (P31176) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 326 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -1 Query: 94 IDSVFGFKICSLGRLNASI 38 I+S+ GFK+C+ GRLN+ + Sbjct: 170 INSILGFKLCTDGRLNSHL 188
>FABH_PORPU (P51196) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 326 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -1 Query: 94 IDSVFGFKICSLGRLNASI 38 I+S+ GFK+C+ GRLN+ + Sbjct: 170 INSILGFKLCTDGRLNSHL 188
>PSD_WIGBR (Q8D2C6) Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65)| [Contains: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] Length = 287 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 13/68 (19%) Frame = +1 Query: 49 LTDQGYIS*TQKL-------------SQYDITRDLYQHQQMVIILLRPKRHYR*HVNRTN 189 +T+ GYI T+KL +Q + D++QH L PK ++R H+ Sbjct: 89 ITNFGYIENTEKLQLKNHNYTLKSLLAQNETMIDIFQHGIFFTTYLSPKNYHRIHMPCDG 148 Query: 190 NILLTVHI 213 +++ +++ Sbjct: 149 SLIKMIYV 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,420,437 Number of Sequences: 219361 Number of extensions: 934976 Number of successful extensions: 2339 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2334 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
