Clone Name | rbastl54f12 |
---|---|
Clone Library Name | barley_pub |
>LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 56.2 bits (134), Expect = 2e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYPNTSDHKGAAAGLTAKGIPNSISI Sbjct: 836 LLYPNTSDHKGAAAGLTAKGIPNSISI 862
>LOX3_ORYSA (Q7G794) Putative lipoxygenase 3 (EC 1.13.11.12)| Length = 866 Score = 48.9 bits (115), Expect = 4e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYPNTSD GAAAG+TAKGIPNSISI Sbjct: 840 LLYPNTSDVTGAAAGITAKGIPNSISI 866
>LOX1_ORYSA (Q76I22) Lipoxygenase 1 (EC 1.13.11.12) (9-lipoxygenase) (r9-LOX1)| Length = 863 Score = 47.4 bits (111), Expect = 1e-05 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +++PNTSD+KGAA G+TA+GIPNSISI Sbjct: 837 LMFPNTSDNKGAAEGITARGIPNSISI 863
>LOX2_ORYSA (P29250) Lipoxygenase 2 (EC 1.13.11.12) (Lipoxygenase L-2)| Length = 870 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYPNTSD KG AAGL+A+GIPNSISI Sbjct: 844 LLYPNTSDLKGDAAGLSARGIPNSISI 870
>LOX4_ORYSA (Q53RB0) Probable lipoxygenase 4 (EC 1.13.11.12)| Length = 877 Score = 37.0 bits (84), Expect = 0.014 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -2 Query: 227 VLYPNTSD-HKGAAAGLTAKGIPNSISI 147 +LYPNTSD K GLTA GIPNSISI Sbjct: 850 LLYPNTSDVTKEKGQGLTAMGIPNSISI 877
>LOXX_SOYBN (P24095) Seed lipoxygenase (EC 1.13.11.12)| Length = 864 Score = 32.0 bits (71), Expect = 0.44 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 V P T H+ + GLT KGIPNSISI Sbjct: 838 VQLPYTLLHRSSEEGLTFKGIPNSISI 864
>LOX2_PEA (P14856) Seed lipoxygenase-2 (EC 1.13.11.12)| Length = 864 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 V P T H + GLT +GIPNSISI Sbjct: 838 VQLPYTLLHPSSKEGLTFRGIPNSISI 864
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYP++ + GLT +GIPNSISI Sbjct: 846 LLYPSSEE------GLTCRGIPNSISI 866
>MURE_NITEU (Q82VS8) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 521 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 210 LRPQGGRCRSYRQGHPQQHLHLI*AIGNHG 121 LR + G+ S GHP +HL L+ G +G Sbjct: 90 LRHEAGKIASEAYGHPSRHLWLVGITGTNG 119
>LOX4_SOYBN (P38417) Lipoxygenase-4 (EC 1.13.11.12) (L-4) (VSP94)| Length = 853 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYP++ + GLT +GIPNSISI Sbjct: 833 LLYPSSEE------GLTFRGIPNSISI 853
>LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12)| Length = 861 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYP++ + GLT +GIPNSISI Sbjct: 841 LLYPSSKE------GLTFRGIPNSISI 861
>LOX1_SOYBN (P08170) Seed lipoxygenase-1 (EC 1.13.11.12) (L-1)| Length = 839 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 227 VLYPNTSDHKGAAAGLTAKGIPNSISI 147 +LYP++ + GLT +GIPNSISI Sbjct: 819 LLYPSSEE------GLTFRGIPNSISI 839 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,149,286 Number of Sequences: 219361 Number of extensions: 503445 Number of successful extensions: 1187 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1187 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)