Clone Name | rbastl54f05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GP115_HUMAN (Q8IZF3) Probable G-protein coupled receptor 115 (G-... | 29 | 2.8 | 2 | ADPPT_XENLA (Q6DJH2) L-aminoadipate-semialdehyde dehydrogenase-p... | 28 | 4.7 | 3 | PMPG_CHLTR (O84879) Probable outer membrane protein pmpG precurs... | 28 | 8.1 |
---|
>GP115_HUMAN (Q8IZF3) Probable G-protein coupled receptor 115 (G-protein coupled| receptor PGR18) Length = 752 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 70 QIPTGREQNFRIQ*KCSGRSAVSSAWISSPCCLFYH 177 Q P G+ + RIQ KC G +SS+ S PC +H Sbjct: 94 QSPEGKPKTGRIQEKCEG-PCISSSNCSQPCAKDFH 128
>ADPPT_XENLA (Q6DJH2) L-aminoadipate-semialdehyde| dehydrogenase-phosphopantetheinyl transferase (EC 2.7.8.-) (4'-phosphopantetheinyl transferase) (Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase) (AASD-PPT) Length = 302 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 170 FITIGSRSTYPCVNSSLLHRNKY 238 F+T GS S YPC N ++ H+ Y Sbjct: 90 FLTGGSSSEYPCFNFNVSHQGDY 112
>PMPG_CHLTR (O84879) Probable outer membrane protein pmpG precursor| (Polymorphic membrane protein G) Length = 1013 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 85 REQNFRIQ*KCSGRSAVSSAWISSPCCLFYHDR 183 R + IQ GRS W+S FYHDR Sbjct: 721 RSAHSAIQASVDGRSYCRGLWVSGVSNFFYHDR 753 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,546,584 Number of Sequences: 219361 Number of extensions: 689876 Number of successful extensions: 1732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)