| Clone Name | rbastl54f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCAM_SCHPO (Q9P7E3) S-adenosylmethionine decarboxylase proenzyme... | 30 | 1.5 | 2 | MOP_DESGI (Q46509) Aldehyde oxidoreductase (EC 1.2.99.7) (Molybd... | 29 | 2.6 | 3 | DODA_PORGR (Q7XA48) 4,5-DOPA dioxygenase extradiol (EC 1.13.-.-) | 29 | 2.6 | 4 | CRTX_ENTAG (Q01330) Zeaxanthin glucosyl transferase (EC 2.4.1.-) | 27 | 9.9 |
|---|
>DCAM_SCHPO (Q9P7E3) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 378 Score = 30.0 bits (66), Expect = 1.5 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +2 Query: 110 SSLMHERTTSLIHLKGQEHWCYNSFSTRLLQ---G*HIRQVVEKEAAKHRVEK--ITAFD 274 S+++++ + IH+ QEH Y SF T + Q G I + +EK K +T F Sbjct: 276 SNMIYKDRYATIHVTPQEHCSYASFETNVSQFQFGRSISETIEKTVKTFGANKFCLTLFQ 335 Query: 275 GALASNE 295 AS E Sbjct: 336 AKGASQE 342
>MOP_DESGI (Q46509) Aldehyde oxidoreductase (EC 1.2.99.7) (Molybdenum iron| sulfur protein) Length = 907 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 61 HNIISEFTGALSFHGCQFLDA*TYNIPNPSQGARTLVLQQLFDKTITG 204 H SEF L+ G QF+ A YNIPN RT+ ++ G Sbjct: 488 HGPYSEFGDLLTLRGAQFIGA-GYNIPNIRGLGRTVATNHVWGSAFRG 534
>DODA_PORGR (Q7XA48) 4,5-DOPA dioxygenase extradiol (EC 1.13.-.-)| Length = 271 Score = 29.3 bits (64), Expect = 2.6 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = -3 Query: 257 FQHGVWLPLSRRLDECVTPVIVLS-----KSCCNTNV---LAP*DGLGMLYVHASRN*HP 102 F H W+PLS E PV LS + + NV LAP G G+L++ + HP Sbjct: 119 FDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHP 178 Query: 101 *KD 93 D Sbjct: 179 SDD 181
>CRTX_ENTAG (Q01330) Zeaxanthin glucosyl transferase (EC 2.4.1.-)| Length = 413 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 239 LPLSRRLDECVTPVIVLSKS 180 LP RRLDEC++P+ +S+S Sbjct: 185 LPERRRLDECLSPLAQISQS 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,644,465 Number of Sequences: 219361 Number of extensions: 878810 Number of successful extensions: 2066 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2066 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)