| Clone Name | rbastl54d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAAR6_MOUSE (Q5QD13) Trace amine-associated receptor 6 | 27 | 8.9 |
|---|
>TAAR6_MOUSE (Q5QD13) Trace amine-associated receptor 6| Length = 345 Score = 27.3 bits (59), Expect = 8.9 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = -2 Query: 336 FSGSV----VFPSKFSNISQKGFELGGCKVEINVAWSLLIESQYDISVMGSIQPYAWESI 169 +SG+V V+ +S +GGC+V +N W L+ + I + I Y + Sbjct: 163 YSGAVFYTGVYDDGLEELSSALNCVGGCQVVVNQNWVLIDFLSFLIPTLVMIILYGNIFL 222 Query: 168 PRRPVMKLVEDVGS 127 R K +E++GS Sbjct: 223 VARQQAKKIENIGS 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,915,508 Number of Sequences: 219361 Number of extensions: 923474 Number of successful extensions: 1654 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1654 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)