Clone Name | rbastl54c12 |
---|---|
Clone Library Name | barley_pub |
>GRK5_HUMAN (P34947) G protein-coupled receptor kinase 5 (EC 2.7.11.16) (G| protein-coupled receptor kinase GRK5) Length = 590 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 18 FTNVRQLGKTGVSLPHLNFL*RGHPPHPQKKG 113 F + G G P LN R HPP P KKG Sbjct: 521 FKELNVFGPNGTLPPDLN---RNHPPEPPKKG 549
>TS1R1_MOUSE (Q99PG6) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) Length = 842 Score = 28.1 bits (61), Expect = 6.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 162 LFLLGPTGIFVWKLILPLFFADGGDVPFI 76 L L+G G+F W+L P+ + GG + F+ Sbjct: 580 LLLIGTAGLFAWRLHTPVVRSAGGRLCFL 608
>PPCE_FLAME (P27028) Prolyl endopeptidase precursor (EC 3.4.21.26)| (Proline-specific endopeptidase) (PSE) (Post-proline cleaving enzyme) (PE) Length = 705 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = +2 Query: 11 NIIYKRKAIGKNWSFIAPFEFSIKGT---SPPSAKKRGSI 121 +++Y++ A GK F+ P +FS KGT + S K+G++ Sbjct: 119 SVLYRKDAAGKTEVFLDPNKFSEKGTTSLASVSFNKKGTL 158
>CAF5_SCHPO (O94528) Caffeine resistance protein 5| Length = 531 Score = 28.1 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 168 GSLFLLGPTGIFVWKLILPLFFADGGD 88 G+L L +F++K+++P F A GGD Sbjct: 366 GALITLACYFVFLYKVMIPAFMASGGD 392
>TS1R1_HUMAN (Q7RTX1) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) (Gm148) Length = 841 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 162 LFLLGPTGIFVWKLILPLFFADGGDVPFI 76 L LLG G+F W L P+ + GG + F+ Sbjct: 579 LLLLGTAGLFAWHLDTPVVRSAGGRLCFL 607
>GRK5_BOVIN (P43249) G protein-coupled receptor kinase 5 (EC 2.7.11.16) (G| protein-coupled receptor kinase GRK5) Length = 590 Score = 27.7 bits (60), Expect = 8.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 18 FTNVRQLGKTGVSLPHLNFL*RGHPPHPQKKG 113 F + G G P LN R HPP P KKG Sbjct: 521 FKELNVFGPHGTLSPDLN---RSHPPEPPKKG 549
>POL2_BRSV (P14547) RNA2 polyprotein (P2) [Contains: P2A protein (2A);| Movement protein (2B-MP); Coat protein (2C-CP)] Length = 1357 Score = 27.7 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 106 FCGWGGCPLYRKFKWGNETPVFPNC 32 FC GG PL + KW +E P+C Sbjct: 95 FCSCGGIPLPGENKWEDELVPIPDC 119
>HV16_MOUSE (P01783) Ig heavy chain V region MOPC 21 precursor (Fragment)| Length = 136 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 121 DTAPFFCG-WGGCPLYRKFKWGNETPV 44 DTA ++C WG P Y WG T V Sbjct: 106 DTAMYYCARWGNYPYYAMDYWGQGTSV 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,609,976 Number of Sequences: 219361 Number of extensions: 478302 Number of successful extensions: 1521 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1521 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)