Clone Name | rbastl54c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MUTS_COLP3 (Q47WN0) DNA mismatch repair protein mutS | 30 | 2.7 | 2 | SWC4_YARLI (Q6C9M6) SWR1-complex protein 4 | 29 | 6.0 |
---|
>MUTS_COLP3 (Q47WN0) DNA mismatch repair protein mutS| Length = 872 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/74 (25%), Positives = 37/74 (50%) Frame = -1 Query: 407 GHPNIGLKSCR*RAAEINAWSSLFMMP*APLTDDCIMHAWWRPQNHSYQASGVDTHFSLL 228 G P +K + R +E+ + ++P AP+ +D + P+ HS + +DT + L Sbjct: 798 GVPKTVIKRAKQRLSELEQQQTPSILP-APIQNDAFEQLSFAPEEHSVVTTLIDTDINEL 856 Query: 227 VVE*AGDLICALQD 186 A DL+ +L++ Sbjct: 857 SPRQALDLLFSLKE 870
>SWC4_YARLI (Q6C9M6) SWR1-complex protein 4| Length = 504 Score = 28.9 bits (63), Expect = 6.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 321 GLGHHEQTTPSIYLSGPSSTTLQPDI 398 G+ +H++ TP +YL TT +P I Sbjct: 417 GISYHDKLTPGVYLRSSKVTTFKPTI 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,219,320 Number of Sequences: 219361 Number of extensions: 1383783 Number of successful extensions: 2474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2474 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)