Clone Name | rbastl54b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INX2_SCHAM (Q9XYN1) Innexin inx2 (Innexin-2) (G-Inx2) | 29 | 3.4 | 2 | FCRL5_HUMAN (Q96RD9) Fc receptor-like protein 5 precursor (Immun... | 28 | 7.7 |
---|
>INX2_SCHAM (Q9XYN1) Innexin inx2 (Innexin-2) (G-Inx2)| Length = 359 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -2 Query: 228 QFANSGDLQSFXXXXXXXANIVSGVLYTSIYFETTRCWWLI-SVLSFGGMIYKLS 67 ++ SG +Q+F NIV+ +Y ++F W++I SVL+ G++Y+L+ Sbjct: 242 KYGPSGSVQTFDGLCVLPLNIVNEKIYVFLWF-----WFVILSVLTGIGLVYRLA 291
>FCRL5_HUMAN (Q96RD9) Fc receptor-like protein 5 precursor (Immunoglobulin| receptor translocation-associated gene 2 protein) (BXMAS1) (CD307 antigen) Length = 977 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = +1 Query: 103 GNQPPTSGGLKINASVQHAAYNIXXXXXXXLEALKITRICKLDASTPVSGDLAIIYSIQH 282 G +P + L + V H N+ E K+T C+ G L I+Y H Sbjct: 362 GAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQ-----RGSLPILYQFHH 416 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,511,817 Number of Sequences: 219361 Number of extensions: 717698 Number of successful extensions: 1501 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1501 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)