Clone Name | rbastl54a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRK1_SCHPO (P47946) Potassium transport protein 1 | 30 | 2.1 | 2 | NINAG_DROME (Q9VGP2) Neither inactivation nor afterpotential pro... | 29 | 2.7 | 3 | DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV) | 28 | 4.6 | 4 | BGAL_BACST (P19668) Beta-galactosidase 1 (EC 3.2.1.23) (Beta-gal... | 28 | 7.9 |
---|
>TRK1_SCHPO (P47946) Potassium transport protein 1| Length = 841 Score = 29.6 bits (65), Expect = 2.1 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = +1 Query: 58 ANCSVSQLFNIRCKLVTHG*QNLHKHGGIPLSVKHGVTGPSYHIFLFCESD*QYHMHLQL 237 +NCS+S F KLV + +H G+P +V + PS L E D Q + Sbjct: 770 SNCSLSARFTTISKLVIIALELRGRHRGLPRAVDRAILLPSEKNNLKEEEDYQRRHGFSI 829 Query: 238 IRTRGS 255 RGS Sbjct: 830 DNARGS 835
>NINAG_DROME (Q9VGP2) Neither inactivation nor afterpotential protein G| precursor (EC 1.-.-.-) Length = 581 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 121 NLHKHGGIPLSVKHGVTGPS 180 NLH H +PL V GVTGP+ Sbjct: 307 NLHDHFNLPLFVSMGVTGPT 326
>DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 354 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 71 SLNFSTYDVSWSLMDDKIYISTEVYPYRLNMVSP 172 S N STYD W ++++K+Y E RL SP Sbjct: 254 SQNISTYDECWQVIEEKLYPELE---KRLERASP 284
>BGAL_BACST (P19668) Beta-galactosidase 1 (EC 3.2.1.23) (Beta-galactosidase I)| (Lactase) Length = 672 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 29 KAQNLTKQNWPTVLSLNFSTYDVSWSLMDDKIY 127 + Q W ++ +N + Y+V+ SL +DKIY Sbjct: 607 EVQQRETDEWKYLIIINHNDYEVTLSLPEDKIY 639 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,229,471 Number of Sequences: 219361 Number of extensions: 615796 Number of successful extensions: 1182 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)