Clone Name | rbastl53h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DJLA_MANSM (Q65RA1) DnaJ-like protein djlA | 30 | 2.1 | 2 | DUS4_MOUSE (Q8BFV3) Dual specificity protein phosphatase 4 (EC 3... | 28 | 4.7 | 3 | AMNLS_MOUSE (Q99JB7) Amnionless protein precursor | 28 | 6.2 | 4 | GH34_ORYSA (Q60EJ6) Probable indole-3-acetic acid-amido syntheta... | 28 | 6.2 |
---|
>DJLA_MANSM (Q65RA1) DnaJ-like protein djlA| Length = 288 Score = 29.6 bits (65), Expect = 2.1 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -3 Query: 246 QTANLQLNTVPRTTIKVEEEEEDLQNNLRSQVWSDGAARHCARLALQGGK 97 QT L + + +V EE+ L NNL SQ+ D A R A+ A GK Sbjct: 59 QTTFAVLGHLSKAKGRVTEEDIQLANNLMSQMQLDVANRQLAQNAFNRGK 108
>DUS4_MOUSE (Q8BFV3) Dual specificity protein phosphatase 4 (EC 3.1.3.48) (EC| 3.1.3.16) Length = 398 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 144 DGAARHCARLALQGGKCLV*NCRP 73 +G+ H A L GGKCL+ +CRP Sbjct: 33 NGSGSHGALGLLSGGKCLLLDCRP 56
>AMNLS_MOUSE (Q99JB7) Amnionless protein precursor| Length = 458 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 8 GGITLLAMLLLFITVTILYRREGRQFYTRH 97 GG+ L +L L TV +L R GR + RH Sbjct: 365 GGVAALVLLALLGTVLLLLHRSGRLRWRRH 394
>GH34_ORYSA (Q60EJ6) Probable indole-3-acetic acid-amido synthetase GH3.4 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 4) (OsGH3-4) Length = 629 Score = 28.1 bits (61), Expect = 6.2 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -2 Query: 244 NGKPPTKYRPKNHHQSGRRRRRPTE*FEIAGVERRSGSPLC*TSITGRQVPGV 86 +GKP +++ + G R+ PT E+ ERRSG + RQVPG+ Sbjct: 103 SGKPVSEFLTSSGTSGGERKLMPTIEEEM---ERRSGLYSLLMPVMSRQVPGL 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,347,237 Number of Sequences: 219361 Number of extensions: 614435 Number of successful extensions: 2016 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2014 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)