Clone Name | rbastl53h08 |
---|---|
Clone Library Name | barley_pub |
>NU4M_LOCMI (Q36424) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 444 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -2 Query: 290 MPFICCHSMN*PWWGSFWSLY*CIGVVRVIQGFVNGRSGLFCL 162 M + C M WWG C+G + ++ G SGLFCL Sbjct: 282 MSLVICGLMTMNWWG-------CMGSLSLMIGHGISSSGLFCL 317
>O51T1_HUMAN (Q8NGJ9) Olfactory receptor 51T1| Length = 327 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 287 PFICCHSMN*PWWGSFWSLY*CIGVVRVIQGFVNGRSGLFCLVSALMMSQT 135 P + ++ + PW SFW L+ +Q ++NG LF L S +++ +T Sbjct: 184 PEVIKYTYSKPWISSFWGLF--------LQLYLNGTDVLFILFSYVLILRT 226
>FKBP9_RAT (Q66H94) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) Length = 570 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -1 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) Length = 570 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -1 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>FKBP9_HUMAN (O95302) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) Length = 570 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -1 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>NU5M_TRYBB (P04540) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 590 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -2 Query: 194 FVNGRSGLFCLVSALMMSQTSVCPIITF-----CLELLVYLIRVVLYFVDFFFLTLNFTC 30 F+ GR+ L +S +M+ +C I +F CL Y ++ +DF F+ L + C Sbjct: 19 FMFGRNFLSFWLSLVMIIFIVLCMIFSFLMVSVCLYGYYYYDFCLILMLDFCFIWLTYVC 78 Query: 29 S 27 S Sbjct: 79 S 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,079,699 Number of Sequences: 219361 Number of extensions: 800160 Number of successful extensions: 1724 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1724 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)