Clone Name | rbastl53g12 |
---|---|
Clone Library Name | barley_pub |
>GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 634 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 274 CN*LQSCLVARMDRHATCTHSGGHVGVELVVSFDLKLICTCI 149 CN +S LV D TH+G +GV SF +L+C + Sbjct: 387 CNGARSTLVRESDA-VLLTHAGSEIGVASTKSFTTQLVCLLV 427
>PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-)| Length = 758 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 117 SSKDVTFSTHLIHVQISLRSKDTTSSTPTCP 209 SSK + S+HL H+ + S +T + TCP Sbjct: 145 SSKSGSLSSHLFHLATAFGSPNTFTHASTCP 175
>NPY6R_RABIT (P79217) Neuropeptide Y receptor type 6 (NPY6-R)| Length = 371 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 146 VCTESYIFRTDTALSFTSTVCLAFFVDLRSLIFCGVYVSSC 24 VC E + +T+ L TS + L +FV L + C + + C Sbjct: 195 VCVEHWPSKTNQLLYSTSLIMLQYFVPLGFMFICYLKIVIC 235
>LSHB_HORSE (P08751) Lutropin/choriogonadotropin beta chain precursor| (LSH-B/CG-B) (Lutenizing hormone beta subunit) Length = 169 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 235 RHATCTHSGGHVGVELVVSFDLKLICTCIKCVLKVTSLELIR 110 R A+ G GV+ +VSF + L C C C +K T + R Sbjct: 83 RFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFR 124
>AMYG_NEUCR (P14804) Glucoamylase precursor (EC 3.2.1.3) (Glucan| 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase) Length = 626 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 131 YIFRTDTALSFTSTVCLAFFVDLRSLIFCGVYVSSCAT 18 Y+++ +++ TST LAFF DL + G Y SS +T Sbjct: 368 YVWKKQGSITVTST-SLAFFKDLVPSVSTGTYSSSSST 404
>M4A8A_MOUSE (Q99N10) Membrane-spanning 4-domains subfamily A member 8A (CD20| antigen-like 5) (Fragment) Length = 287 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +2 Query: 194 NSYMSTRVGTSGMPVHSGNQTRLQLVTALVDGIKMFLDEPPA 319 NSY MP++ NQ ++ +++ + G+ + EPPA Sbjct: 56 NSYPVVPGTVPQMPIYPSNQPQVHVISGHLPGLVPAMTEPPA 97
>COMA_CONMA (Q9TWL9) Conodipine-M alpha chain (EC 3.1.1.4)| Length = 77 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 262 QSCLVARMDRHATCTHSGGHVG 197 Q +A DRH TC H G H G Sbjct: 26 QKXFLAACDRHDTCYHCGKHFG 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,884,433 Number of Sequences: 219361 Number of extensions: 1239149 Number of successful extensions: 3262 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3262 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)