Clone Name | rbastl53g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | QUEA_THIDN (Q30PZ7) S-adenosylmethionine:tRNA ribosyltransferase... | 29 | 2.5 | 2 | PUR4_NEIMB (Q9JXK5) Phosphoribosylformylglycinamidine synthase (... | 28 | 7.3 | 3 | PUR4_NEIMA (Q9JWC5) Phosphoribosylformylglycinamidine synthase (... | 28 | 7.3 | 4 | UL10_HCMVA (P16843) Hypothetical protein UL10 | 27 | 9.5 | 5 | SP60_DICDI (P15270) Spore coat protein SP60 precursor | 27 | 9.5 |
---|
>QUEA_THIDN (Q30PZ7) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC| 5.-.-.-) (Queuosine biosynthesis protein queA) Length = 342 Score = 29.3 bits (64), Expect = 2.5 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 59 RKSDGLSHVAFFDPSYILPPYQNNCLNFVLILV*NCTK-LKTLILGQF*DGGSISRQLSL 235 R SD +SHV F+D +P NC L+ N TK +K + GQ GG I ++ Sbjct: 38 RASDEISHVHFYDFEKFIP---KNC-----ALIFNDTKVIKARLFGQKESGGKIELLINR 89 Query: 236 GSTSGAIH 259 + IH Sbjct: 90 ALDAHNIH 97
>PUR4_NEIMB (Q9JXK5) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1320 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 243 RQVPFIQHAKKPLRARCSNNQEDYEHSI 326 R+VP +H PL+ C+ +QE Y SI Sbjct: 528 REVPLEEHGLNPLQIWCNESQERYVLSI 555
>PUR4_NEIMA (Q9JWC5) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1320 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 243 RQVPFIQHAKKPLRARCSNNQEDYEHSI 326 R+VP +H PL+ C+ +QE Y SI Sbjct: 528 REVPLEEHGLNPLQIWCNESQERYVLSI 555
>UL10_HCMVA (P16843) Hypothetical protein UL10| Length = 258 Score = 27.3 bits (59), Expect = 9.5 Identities = 21/55 (38%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -2 Query: 324 WSAHNPPGCLSILHVRVSLHAE*MAPDVLPSESCRDMLPPS*NC--PKISVLSLV 166 + HN LSILHV VS P CR PP+ NC P LSL+ Sbjct: 100 YECHN--STLSILHVNVSD----------PKNYCRRKCPPNGNCEFPTCFTLSLI 142
>SP60_DICDI (P15270) Spore coat protein SP60 precursor| Length = 424 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 287 CT*GFLCMLNEWHLTCC-QVKAAVICSLR 204 C G C ++EW CC ++K IC LR Sbjct: 122 CPEGHECKVDEWGKECCVKIKCDDICDLR 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,765,144 Number of Sequences: 219361 Number of extensions: 872234 Number of successful extensions: 1598 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1598 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)