Clone Name | rbastl53f11 |
---|---|
Clone Library Name | barley_pub |
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 329 VPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLFHG 213 VP A+ SL + V+ +R +P+ LF+Y HT L+HG Sbjct: 192 VPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHG 231
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 275 LRMDIPSKLFSYEHTAVLFHG 213 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>PXDC2_XENLA (Q6DE92) Plexin domain-containing protein 2 precursor| Length = 513 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 19/51 (37%) Frame = -2 Query: 375 CSWCKV-------------------CSEDSKQGVCASIL*SYGVSYQVSDG 280 CSWC + C+E+SK VC +L + G+S+ + G Sbjct: 331 CSWCNIPQRCSSGFDRHRQDWVENGCTEESKDTVCDDLLQTTGISHHTTTG 381
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -1 Query: 232 QLCCFMEVSVNCIVLLLCYFYFTVFKLLVSWFQNFLGILILDIL 101 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169
>ISK5_HUMAN (Q9NQ38) Serine protease inhibitor Kazal-type 5 precursor| (Lympho-epithelial Kazal-type-related inhibitor) (LEKTI) [Contains: Hemofiltrate peptide HF6478; Hemofiltrate peptide HF7665] Length = 1064 Score = 27.7 bits (60), Expect = 6.9 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 7 QIKKKQGVFSCTMT*QEKFRLVKGKIY-NLCGTKCPG*VSLENSETKKLTA*IR*SRSNT 183 Q + K G+ CT + R GK++ NLC + C EN E KK A R R + Sbjct: 301 QNQAKNGILFCTRE-NDPIRGPDGKMHGNLC-SMCQAYFQAENEEKKKAEARARNKRESG 358 Query: 184 ITTQY 198 T Y Sbjct: 359 KATSY 363
>MUKB_MANSM (Q65TL9) Chromosome partition protein mukB (Structural maintenance| of chromosome-related protein) Length = 1499 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 314 QRIEAQ-TPCLESSLHTLHQEHQRQQ 388 Q+++AQ TP L + LH L Q +Q+QQ Sbjct: 537 QKLQAQQTPQLRAKLHELEQRYQQQQ 562
>UHMK1_RAT (Q63285) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) (PAM COOH-terminal interactor protein 2) (P-CIP2) Length = 419 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 319 NRGTNSLFGVFTAHFAPGAPT 381 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_MOUSE (P97343) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 319 NRGTNSLFGVFTAHFAPGAPT 381 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>UHMK1_HUMAN (Q8TAS1) Serine/threonine-protein kinase Kist (EC 2.7.11.1) (Kinase| interacting with stathmin) (U2AF homology motif kinase 1) Length = 419 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 319 NRGTNSLFGVFTAHFAPGAPT 381 +R +L+GVFT HF+P P+ Sbjct: 86 HRNIVTLYGVFTIHFSPNVPS 106
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 27.3 bits (59), Expect = 9.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 384 CRWCSWCKVCSEDS 343 C+WC WC+ C S Sbjct: 1044 CKWCVWCRHCGATS 1057
>ATP6_AEDAL (Q5JCK5) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 27.3 bits (59), Expect = 9.0 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -1 Query: 166 TVFKLLVSWFQNFLGILIL 110 T+F + ++WF F+G+LI+ Sbjct: 14 TIFNMSLNWFSTFIGLLII 32
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 27.3 bits (59), Expect = 9.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 384 CRWCSWCKVCSEDS 343 C+WC WC+ C S Sbjct: 1051 CKWCVWCRHCGATS 1064 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,699,746 Number of Sequences: 219361 Number of extensions: 926437 Number of successful extensions: 2355 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2354 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)