ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl53e10 |
|---|---|
| Clone Library Name | barley_pub |
>GID_BACSK (Q5WFP8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 436 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -1 Query: 183 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 25 + L C +L+G +L N V +L H D + G + +D +D Sbjct: 50 AELVCSNSLRGNSLANAVGVLKEEMRHLDSVIIKAADEAAVPAGGALAVDRHD 102
>GID_STAES (Q8CPH2) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -1 Query: 183 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 25 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>GID_STAEQ (Q5HPU1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -1 Query: 183 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 25 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>POLG_HCVGL (Q5EG65) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23)] (Fragment) Length = 828 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 8/32 (25%) Frame = -1 Query: 237 PSPGRRGPTWCSTSPRRRSR--------LTCG 166 PSP P+W PRRRSR LTCG Sbjct: 97 PSPRGSRPSWGPNDPRRRSRNLGKVIDTLTCG 128
>RLM1_YEAST (Q12224) Transcription factor RLM1| Length = 676 Score = 28.1 bits (61), Expect = 6.2 Identities = 22/73 (30%), Positives = 32/73 (43%) Frame = +3 Query: 45 HLHKYKPLLKFYSVKMPRQNDQRVCIKYLPC*SMPCLSNSYHRSAYSAGGARLSTMSGPF 224 HL + KP S +Q Q + S P S+ Y+ + S+ + STM P Sbjct: 191 HLKRLKPDPLQISRTPQQQQQQNI--------SRPYHSSMYNLNQPSSSSSSPSTMDFPK 242 Query: 225 SPATENSSGTGTP 263 P+ +NSS G P Sbjct: 243 LPSFQNSSFNGRP 255
>POLG_HCVHK (Q01403) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 519 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVH4 (Q01404) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 519 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>KCNH4_HUMAN (Q9UQ05) Potassium voltage-gated channel subfamily H member 4| (Voltage-gated potassium channel subunit Kv12.3) (Ether-a-go-go-like potassium channel 1) (ELK channel 1) (ELK1) (Brain-specific eag-like channel 2) (BEC2) Length = 1017 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSRLTCGR 163 S GRRG TW S RRRSR R Sbjct: 155 SLGRRGATWKFRSARRRSRTVLHR 178
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVJT (Q00269) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVJA (P26662) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVCO (Q9WMX2) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVJ2 (P27959) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 512 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 234 SPGRRGPTWCSTSPRRRSR--------LTCG 166 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,677,352 Number of Sequences: 219361 Number of extensions: 678269 Number of successful extensions: 2312 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2309 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
