| Clone Name | rbastl53e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YAEC_SCHPO (Q09852) Putative inorganic phosphate transporter C23... | 28 | 7.2 | 2 | VILI4_ARATH (O65570) Villin-4 | 28 | 7.2 | 3 | NOS_DROME (Q27571) Nitric-oxide synthase (EC 1.14.13.39) (dNOS) | 27 | 9.4 | 4 | DP2L_ARCFU (O28552) DNA polymerase II large subunit (EC 2.7.7.7)... | 27 | 9.4 |
|---|
>YAEC_SCHPO (Q09852) Putative inorganic phosphate transporter C23D3.12| Length = 559 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 226 VQRSGKKKVHHGLW*WYWN 282 V R G K H G W WY+N Sbjct: 538 VLRGGNGKTHQGRWSWYFN 556
>VILI4_ARATH (O65570) Villin-4| Length = 974 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 306 QITRTYQQIPVPSPKSMMNLFFSTSLYIKLK 214 +I R IP P PKS + FF+ YI LK Sbjct: 22 EIWRIENFIPTPIPKSSIGKFFTGDSYIVLK 52
>NOS_DROME (Q27571) Nitric-oxide synthase (EC 1.14.13.39) (dNOS)| Length = 1349 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 150 LSYIGXXXXXXXXXXQLMHMGFLILCTEK-WKKKGSSWTLV 269 +SY G M++ F +CT+ WK KGS W ++ Sbjct: 393 ISYAGYKQADGKIIGDPMNVEFTEVCTKLGWKSKGSEWDIL 433
>DP2L_ARCFU (O28552) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1143 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 298 CDLAGSTTHQGFYCPSGR 351 CD+ G T Q +YCPS R Sbjct: 663 CDVCGELTEQLYYCPSCR 680 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,495,745 Number of Sequences: 219361 Number of extensions: 1182042 Number of successful extensions: 2131 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2131 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)