Clone Name | rbastl53c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III | 31 | 1.6 | 2 | IRK14_RAT (O70596) ATP-sensitive inward rectifier potassium chan... | 29 | 4.7 | 3 | IRK14_MOUSE (Q8JZN3) ATP-sensitive inward rectifier potassium ch... | 29 | 4.7 | 4 | VD05_VARV (P33069) Protein D5 | 28 | 8.1 | 5 | YHD9_YEAST (P38732) Protein YHL039W | 28 | 8.1 |
---|
>YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III| Length = 734 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -1 Query: 344 SYVRPLPSCALEIETGMPLVTSSCPILTAFLPLHGH-TPEYKSDHMKCVKHFTQRHLRPN 168 SYV+P+ S + + S P L+ +P HG PE D M ++ + Q H+R N Sbjct: 534 SYVKPIMSTHIH----QTIKAQSIPYLSRAIPSHGRGEPELDEDEM-WIQKYPQGHVRNN 588 Query: 167 TD 162 D Sbjct: 589 MD 590
>IRK14_RAT (O70596) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 371 PPPLFAFSQLPTFKSAFLFLEESQ 442 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>IRK14_MOUSE (Q8JZN3) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 371 PPPLFAFSQLPTFKSAFLFLEESQ 442 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +2 Query: 44 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 223 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 224 C----IPVCGHEV 250 C +P+ G+++ Sbjct: 314 CKVKIVPLDGNKL 326
>YHD9_YEAST (P38732) Protein YHL039W| Length = 585 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 426 NKKALLNVGSWEKANKGGGDKL-IMLPPQLRSSTP 325 N+K LLN G W+ +NK +L + LP L S P Sbjct: 285 NEKCLLNYGFWDSSNKFDFSRLTLKLPSTLVSGLP 319 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,534,793 Number of Sequences: 219361 Number of extensions: 1306261 Number of successful extensions: 2905 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2905 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)