| Clone Name | rbastl53c01 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_HCVGL (Q5EG65) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23)] (Fragment) Length = 828 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 8/42 (19%) Frame = -1 Query: 237 NWACRCPTSFPSPGRRGPTWCSTSPRRRSR--------LTCG 136 N C PSP P+W PRRRSR LTCG Sbjct: 87 NEGCGWAGWLPSPRGSRPSWGPNDPRRRSRNLGKVIDTLTCG 128
>RLM1_YEAST (Q12224) Transcription factor RLM1| Length = 676 Score = 28.1 bits (61), Expect = 6.3 Identities = 22/73 (30%), Positives = 32/73 (43%) Frame = +3 Query: 15 HLHKYKPLLKFYSVKMPRQNDQRVCIKYLPC*SMPCLSNSYHRSAYSAGGARLSTMSGPF 194 HL + KP S +Q Q + S P S+ Y+ + S+ + STM P Sbjct: 191 HLKRLKPDPLQISRTPQQQQQQNI--------SRPYHSSMYNLNQPSSSSSSPSTMDFPK 242 Query: 195 SPATENSSGTGTP 233 P+ +NSS G P Sbjct: 243 LPSFQNSSFNGRP 255
>POLG_HCVJ2 (P27959) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 512 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVHK (Q01403) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 519 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVH4 (Q01404) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 519 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>KCNH4_HUMAN (Q9UQ05) Potassium voltage-gated channel subfamily H member 4| (Voltage-gated potassium channel subunit Kv12.3) (Ether-a-go-go-like potassium channel 1) (ELK channel 1) (ELK1) (Brain-specific eag-like channel 2) (BEC2) Length = 1017 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSRLTCGR 133 S GRRG TW S RRRSR R Sbjct: 155 SLGRRGATWKFRSARRRSRTVLHR 178
>POLG_HCVJT (Q00269) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVJA (P26662) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVCO (Q9WMX2) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 8/31 (25%) Frame = -1 Query: 204 SPGRRGPTWCSTSPRRRSR--------LTCG 136 SP P+W T PRRRSR LTCG Sbjct: 98 SPRGSRPSWGPTDPRRRSRNLGKVIDTLTCG 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,411,925 Number of Sequences: 219361 Number of extensions: 599938 Number of successful extensions: 2192 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2191 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)