Clone Name | rbastl53b11 |
---|---|
Clone Library Name | barley_pub |
>NU5H_NYCOV (Q5DUY0) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 1849 Score = 31.2 bits (69), Expect = 0.68 Identities = 11/49 (22%), Positives = 29/49 (59%) Frame = -1 Query: 210 LNLPVISFVYCYVLWYARHGQTMYLKLLLGCTDIRYLPVICSCIFSSVI 64 ++ ++ ++ CY++ + ++ Y+ LLL +I YL ++ + + S +I Sbjct: 327 ISCSLLIYILCYIMTELLYSRSFYIDLLLRLLEIIYLDILVNSLISIII 375
>DNJ5G_HUMAN (Q8N7S2) DnaJ homolog subfamily C member 5G (Gamma cysteine string| protein) (Gamma-CSP) Length = 189 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 165 YARHGQT-MYLKLLLGCTDIRYLPVICSCIFSSVIPCCFALVCC 37 Y +HG +YL G +RY ++ SC F +++ C L CC Sbjct: 94 YDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCC 137
>NCKX6_HUMAN (Q6J4K2) Sodium/potassium/calcium exchanger 6 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Solute carrier family 24 member 6) Length = 584 Score = 27.7 bits (60), Expect = 7.5 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = -3 Query: 250 MTTYIAKSSSLLWP*L--TRDFLRILLCFVVCKTRSNYVLKIIIGMH*YSLPAGYLQLYL 77 +TT +A ++L P + +R F R ++ ++V + L + G + GYL LY+ Sbjct: 181 VTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLT--FLMLFRGRVTLAWALGYLGLYV 238 Query: 76 FICHPVLLCT 47 F V+LCT Sbjct: 239 FYVVTVILCT 248
>Y883_HAEIN (P44917) Hypothetical protein HI0883| Length = 456 Score = 27.7 bits (60), Expect = 7.5 Identities = 22/68 (32%), Positives = 27/68 (39%), Gaps = 10/68 (14%) Frame = -1 Query: 192 SFVYCYVLWYARHGQTMYLKLLLGCTDIRYLPVICSCIF----------SSVIPCCFALV 43 SF++ L G +YL L LG IRYLP +F SS C AL Sbjct: 12 SFIWGAPLLILLSGTGLYLTLRLGFIQIRYLPRALGYLFKKDKGGKGDVSSFAALCTALA 71 Query: 42 CCV*IPNI 19 + NI Sbjct: 72 ATIGTGNI 79
>SPIKE_FIPV (P10033) Spike glycoprotein precursor (Peplomer protein) (E2)| Length = 1452 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = -1 Query: 210 LNLPVISFVYCYVLWYARHGQTMYLKLLLGCTDIRYLPVICSCIFSSVIPCCFALVC 40 +NL ++ + YV W Y+ LL+G + +P++ C FS+ CC + C Sbjct: 1378 VNLEWLNRIETYVKW------PWYVWLLIGLVVVFCIPLLLFCCFST--GCCGCIGC 1426
>TPN1_YEAST (P53099) Vitamin B6 transporter TPN1 (Transport of pyridoxine| protein 1) Length = 579 Score = 27.3 bits (59), Expect = 9.9 Identities = 8/37 (21%), Positives = 21/37 (56%) Frame = -1 Query: 114 DIRYLPVICSCIFSSVIPCCFALVCCV*IPNISLTYR 4 D Y+ + C F + +P CF + + + +++++Y+ Sbjct: 297 DTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYK 333
>TPN1_SACPS (Q874L4) Vitamin B6 transporter TPN1 (Transport of pyridoxine| protein 1) Length = 579 Score = 27.3 bits (59), Expect = 9.9 Identities = 8/37 (21%), Positives = 21/37 (56%) Frame = -1 Query: 114 DIRYLPVICSCIFSSVIPCCFALVCCV*IPNISLTYR 4 D Y+ + C F + +P CF + + + +++++Y+ Sbjct: 297 DTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYK 333
>NCKX6_MOUSE (Q925Q3) Sodium/potassium/calcium exchanger 6 precursor| (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Solute carrier family 24 member 6) Length = 585 Score = 27.3 bits (59), Expect = 9.9 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = -3 Query: 250 MTTYIAKSSSLLWP*L--TRDFLRILLCFVVCKTRSNYVLKIIIGMH*YSLPAGYLQLYL 77 +TT +A ++L P + +R FLR + ++V + L +G + GYL LY+ Sbjct: 181 VTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTAL--YLGRITLTWALGYLGLYV 238 Query: 76 FICHPVLLCT 47 F V++CT Sbjct: 239 FYVVTVIICT 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,853,961 Number of Sequences: 219361 Number of extensions: 628977 Number of successful extensions: 1121 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1120 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)