| Clone Name | rbastl53a12 |
|---|---|
| Clone Library Name | barley_pub |
>COX2_TRYCR (P98023) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 210 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = -2 Query: 151 LCSLCIIFVM*LCYICIFLMELCNGYMLWNYVMDMCYETMLYIYGSLFIV 2 +C +C+ + L +F+ ++ N Y W++V +T ++ G +FI+ Sbjct: 23 VCFVCVWICVLLLSTVLFVTKINNIYCTWDFVSSKFVDTYWFVIGVMFIM 72
>UL34_HCMVA (P16812) Hypothetical protein UL34| Length = 407 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 195 CPYRSPMNIQVGTLVDLKDKENHQAYCH--LGLVHVKRHPYS 314 C +S + ++V LV L E H+ CH +GL+H H ++ Sbjct: 163 CGEKSALGVEVHQLVALLPHERHRELCHVLIGLLHQTPHMWA 204
>GR10A_DROME (P58950) Putative gustatory receptor 10a| Length = 408 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -3 Query: 138 VSSLLCNYAIYAYFLWNYA---MDICY 67 VS + ++AIYA+ LWNY D CY Sbjct: 176 VSQVRVHFAIYAFVLWNYTENMADYCY 202
>ATG9_ASHGO (Q75A48) Autophagy-related protein 9| Length = 897 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 154 LLCSLCIIFVM*LCYICIFLMELCNGYMLWNYVMDMCYETML 29 LL L I+F+ CI +L NG+ + +D CYET + Sbjct: 268 LLTLLFIVFISTYMSHCIDYSKLPNGHKFSDVRVDQCYETQI 309
>CYB_TRYBB (P00164) Cytochrome b| Length = 363 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/50 (22%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -2 Query: 154 LLCSLCIIFVM*LCYIC------IFLMELCNGYMLWNYVMDMCYETMLYI 23 ++C +C+ ++ C+IC +FL + G+++ + + +C+ ++LY+ Sbjct: 36 IICGVCLAWLFFSCFICSNWYFVLFLWDFDLGFVIRS--VHICFTSLLYL 83
>RFBS_SALTI (P14168) Paratose synthase (EC 1.-.-.-)| Length = 279 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = -3 Query: 201 MDMKTLDVVANLT*DACFVHCVSSLLCNYAIYAY 100 M ++ L+ +++L DA F++C +SL N ++YAY Sbjct: 86 MPIRVLESISSL--DAVFINCGTSLPPNTSLYAY 117
>VGLM_INSV (Q01260) Envelope polyprotein precursor (M polyprotein) [Contains:| Glycoprotein G1; Glycoprotein G2] Length = 1110 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 169 SYIGCLLCSLCIIFVM*LCYICIFLMELCNGYM 71 S+ + L I+FV L Y+C + +C GY+ Sbjct: 1038 SFFDTVRVVLLILFVFALAYLCSIVATMCRGYV 1070
>SO2A1_RAT (Q00910) Solute carrier organic anion transporter family member 2A1| (Solute carrier family 21 member 2) (Prostaglandin transporter) (PGT) (Matrin F/G 1) Length = 643 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 11/50 (22%) Frame = -2 Query: 331 LIRPWIEYGCLFTCT------RPKWQ*AWWFSLSLRS-----TKVPTWMF 215 ++R +++YG + T T P+W AWW L + S T +P + F Sbjct: 229 MLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFF 278
>SO2A1_MOUSE (Q9EPT5) Solute carrier organic anion transporter family member 2A1| (Solute carrier family 21 member 2) (Prostaglandin transporter) (PGT) Length = 643 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 11/50 (22%) Frame = -2 Query: 331 LIRPWIEYGCLFTCT------RPKWQ*AWWFSLSLRS-----TKVPTWMF 215 ++R +++YG + T T P+W AWW L + S T +P + F Sbjct: 229 MLRIFVDYGRVDTATVNLSPGDPRWIGAWWLGLLISSGFLIVTSLPFFFF 278
>KBAA_BACSU (P16449) KinB signaling pathway activation protein| Length = 198 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 3/81 (3%) Frame = -1 Query: 278 VAISLVVLLIFEID*GSHLDVHWTTVWT*RHLM*WQILHRMLALFIVYHLCYVTMLYMHI 99 + + ++ +I ++ L VH + R W +L LF+ + L YV L+ Sbjct: 53 IGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMYVRFLFFGE 112 Query: 98 SYGTM---QWIYVMELCYGYV 45 S ++ W+ V L +G + Sbjct: 113 SGESLAGYAWLPVFLLIFGVI 133
>YKD0_YEAST (P36099) Hypothetical 23.0 kDa protein in IXR1-TFA1 intergenic| region Length = 201 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 153 CFVHCVSSLLCNYAIYAYFLWNYAM 79 CF +C+ LL Y Y Y+ + Y M Sbjct: 11 CFYYCIIVLLLYYYYYYYYYYYYGM 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,799,573 Number of Sequences: 219361 Number of extensions: 1070148 Number of successful extensions: 2478 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2476 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)