| Clone Name | rbastl53a08 |
|---|---|
| Clone Library Name | barley_pub |
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 395 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 309 C DPP ++P + C+WC WC+ C S Sbjct: 1036 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1064
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 395 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 309 C DPP ++P + C+WC WC+ C S Sbjct: 1029 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1057
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 395 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 309 C DPP ++P + C+WC C C S Sbjct: 1181 CLDPPLLTVPKGGWKCKWCVSCMQCGAAS 1209
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.6 bits (65), Expect = 3.1 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 295 VPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLFHG 179 VP A+ SL + V+ +R +P+ LF+Y HT L+HG Sbjct: 192 VPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHG 231
>MPAA5_AMBEL (P02878) Pollen allergen Amb a 5 (Amb a V) (Allergen Ra5)| Length = 45 Score = 29.6 bits (65), Expect = 3.1 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Frame = -3 Query: 362 RAYCC----RWCSWCKVCSEDSKQEVCA 291 RAYCC R+C W VC E S E+C+ Sbjct: 15 RAYCCSDPGRYCPWQVVCYESS--EICS 40
>MPA5A_AMBPS (P43174) Pollen allergen Amb p 5a precursor (Amb p Va)| Length = 77 Score = 29.6 bits (65), Expect = 3.1 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Frame = -3 Query: 362 RAYCC----RWCSWCKVCSEDSKQEVCA 291 RAYCC R+C W VC E S E+C+ Sbjct: 37 RAYCCSDPGRYCPWQVVCYESS--EICS 62
>PXDC2_XENLA (Q6DE92) Plexin domain-containing protein 2 precursor| Length = 513 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 19/51 (37%) Frame = -3 Query: 341 CSWCKV-------------------CSEDSKQEVCASIL*SYGVSYQVSDG 246 CSWC + C+E+SK VC +L + G+S+ + G Sbjct: 331 CSWCNIPQRCSSGFDRHRQDWVENGCTEESKDTVCDDLLQTTGISHHTTTG 381
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 4.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 241 LRMDIPSKLFSYEHTAVLFHG 179 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>POU1_BRARE (P31366) POU domain protein 1 (ZFPOU1)| Length = 425 Score = 28.5 bits (62), Expect = 6.9 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +1 Query: 235 SLSYPSLT**ETP*LQRIEAQTSCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 405 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>PROC_MYCTU (Q11141) Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C| reductase) Length = 295 Score = 28.5 bits (62), Expect = 6.9 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = -1 Query: 421 ANMDVLYLSAKIPRGTPFLIELTAAVGAPGAKCAVKTPNRKFVPLFFEAMESLIK*VTGN 242 A + + Y +K+P GTP + + A GA R P E + +L V G Sbjct: 105 AGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGV 164 Query: 241 L 239 L Sbjct: 165 L 165
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 28.5 bits (62), Expect = 6.9 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +1 Query: 235 SLSYPSLT**ETP*LQRIEAQTSCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 405 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.5 bits (62), Expect = 6.9 Identities = 12/43 (27%), Positives = 16/43 (37%) Frame = -3 Query: 422 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDSKQEVC 294 C GC S C+ ++ CC+ CS C Q C Sbjct: 96 CSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSC 138
>TRGS_TACTR (P81281) 8.6 kDa transglutaminase substrate| Length = 81 Score = 28.5 bits (62), Expect = 6.9 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -3 Query: 422 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCS 318 C GC S C D + A C+ C +C C+ Sbjct: 6 CSVGCDTSYCPDTSSCNCGTFADYCKCCQYCNACA 40
>PROC_MYCLE (P46725) Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C| reductase) Length = 294 Score = 28.1 bits (61), Expect = 9.0 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = -1 Query: 421 ANMDVLYLSAKIPRGTPFLIELTAAVGAPGAKCAVKTPNRKFVPLFFEAMESLIK*VTGN 242 A + + YL +K+P GTP + + A GA V R FE + ++ V G Sbjct: 104 AGVTITYLESKLPAGTPVVRAMPNAAALVGAGVTVLAKGRFVTGQQFEDVLAMFDAVGGV 163 Query: 241 L 239 L Sbjct: 164 L 164
>AMYB_PAEPO (P21543) Beta/alpha-amylase precursor [Includes: Beta-amylase (EC| 3.2.1.2); Alpha-amylase (EC 3.2.1.1)] Length = 1196 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +3 Query: 285 NRGTNFLFGVFTAHFAPGAPTAAVSSIRNGVPRG----IFADRYSTSI 416 N N+LF T+ + PG+ A +IR G P G + Y+T + Sbjct: 636 NNTKNYLFSTGTSTYTPGS-NGAAGTIRTGAPSGSVLSVVTSTYATDL 682
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 9.0 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -2 Query: 198 QLCCFMEVSVNCIVLLLCYFYFTVFKLLVSWFQNFLGILILDIL 67 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169
>ALBU_MACMU (Q28522) Serum albumin precursor (Fragment)| Length = 600 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 391 KIPR-GTPFLIELTAAVGAPGAKCAVKTPNRKFVP 290 K+P+ TP L+E++ +G GAKC K P K +P Sbjct: 430 KVPQVSTPTLVEVSRNLGKVGAKCC-KLPEAKRMP 463 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,774,628 Number of Sequences: 219361 Number of extensions: 1136037 Number of successful extensions: 3327 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3322 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)