Clone Name | rbastl50g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEMO_RABIT (P20058) Hemopexin precursor | 29 | 4.0 | 2 | XRN1_SCHPO (P40383) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Exonu... | 28 | 8.9 |
---|
>HEMO_RABIT (P20058) Hemopexin precursor| Length = 460 Score = 28.9 bits (63), Expect = 4.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 8 RKGHINTYMIKGELTWHATTRPNPATFLKA 97 R GH + Y+IKG+ W T+ N + K+ Sbjct: 104 RHGHTSVYLIKGDKVWVYTSEKNEKVYPKS 133
>XRN1_SCHPO (P40383) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Exonuclease 2)| (Exonuclease II) (Exo II) (p140) Length = 1328 Score = 27.7 bits (60), Expect = 8.9 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 16 PHQYIHDQR-RANMACHHKAKSSNIFKGREGGRGVE-EAKGMNEQNDHL 156 P IH + + + HH + +GR G RG +K +N ++DH+ Sbjct: 1270 PESLIHKSKSKFSKGNHHSTNGTQSIRGRGGKRGKPLRSKELNRKHDHI 1318 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,821,555 Number of Sequences: 219361 Number of extensions: 245427 Number of successful extensions: 769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)