Clone Name | rbastl50f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YOP1_ASPFU (Q4WTW3) Protein yop1 | 28 | 9.0 | 2 | EX5B_CHLPN (Q9Z7G7) Exodeoxyribonuclease V beta chain (EC 3.1.11.5) | 28 | 9.0 | 3 | TAGB_DICDI (P54683) Prestalk-specific protein tagB precursor (EC... | 28 | 9.0 |
---|
>YOP1_ASPFU (Q4WTW3) Protein yop1| Length = 169 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 55 HYIVEIIIASYVQSYRTRGDHTASESFSEPILERLFVSNKIHAS 186 +YI + ++ ++ +T G SF +P+L R F S A+ Sbjct: 114 YYIFKFVLILWMSLPQTNGAQVVFHSFLQPVLGRFFTSGSTSAN 157
>EX5B_CHLPN (Q9Z7G7) Exodeoxyribonuclease V beta chain (EC 3.1.11.5)| Length = 1050 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 89 FRATEQEAITLLLNLFLSPSWKGCLYLI 172 F+ T+++ ++ NLF+SP + G L+LI Sbjct: 376 FQDTDKQQWSIFSNLFISPKFTGSLFLI 403
>TAGB_DICDI (P54683) Prestalk-specific protein tagB precursor (EC 3.4.21.-)| Length = 1905 Score = 28.1 bits (61), Expect = 9.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 90 NIRGNNYFNNVMYYSSF 40 N NNY+N++ YYSSF Sbjct: 129 NNNNNNYYNSIEYYSSF 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,032,725 Number of Sequences: 219361 Number of extensions: 1247858 Number of successful extensions: 2247 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2247 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)