Clone Name | rbastl50f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PANX1_RAT (P60570) Pannexin-1 | 30 | 2.0 | 2 | PANX1_PONPY (Q5REE3) Pannexin-1 | 30 | 2.0 | 3 | PANX1_MOUSE (Q9JIP4) Pannexin-1 | 30 | 2.0 | 4 | PANX1_HUMAN (Q96RD7) Pannexin-1 | 30 | 2.0 | 5 | EXOC2_CAEEL (Q22706) Probable exocyst complex component 2 (Exocy... | 29 | 4.5 | 6 | SDK1_HUMAN (Q7Z5N4) Protein sidekick-1 precursor | 29 | 5.9 |
---|
>PANX1_RAT (P60570) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>PANX1_PONPY (Q5REE3) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>PANX1_MOUSE (Q9JIP4) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>PANX1_HUMAN (Q96RD7) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>EXOC2_CAEEL (Q22706) Probable exocyst complex component 2 (Exocyst complex| component Sec5) Length = 884 Score = 29.3 bits (64), Expect = 4.5 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 312 G*RFCKWVKWPLRLSSAAVFTALIFSTSLINASFQNLFSCTH 437 G +F KW P +S + + +L + SLI++ +N FS TH Sbjct: 495 GDQFAKWPTVPADISRSNLQLSLKTTRSLISSLLENQFSLTH 536
>SDK1_HUMAN (Q7Z5N4) Protein sidekick-1 precursor| Length = 2213 Score = 28.9 bits (63), Expect = 5.9 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +3 Query: 39 YKVYCPKSTSRLQSKLRSCPTTLPEF*VERKS-TSYVS*R*LTASFHPAGSGPNDKKKQL 215 YK+Y ++ S+ +++ LPE V K+ TS+ ++F+ AG GP +Q Sbjct: 1737 YKIYYWEADSQNETEKMKV-LFLPEPVVRLKNLTSHTKYLVSISAFNAAGDGPKSDPQQG 1795 Query: 216 YFHLLAVGFINFLAFN 263 H A G +FLAF+ Sbjct: 1796 RTHQAAPGAPSFLAFS 1811 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,954,537 Number of Sequences: 219361 Number of extensions: 889001 Number of successful extensions: 2424 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)