Clone Name | rbastl50e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GSTP1_XENLA (Q8JFZ2) Glutathione S-transferase P 1 (EC 2.5.1.18)... | 29 | 6.3 | 2 | HXC6_XENLA (P02832) Homeobox protein Hox-C6 (XlHbox-1) (AC1) [Co... | 29 | 6.3 | 3 | VL1_HPV18 (P06794) Major capsid protein L1 | 29 | 6.3 |
---|
>GSTP1_XENLA (Q8JFZ2) Glutathione S-transferase P 1 (EC 2.5.1.18) (XlGSTP1-1)| (GST class-pi) Length = 212 Score = 28.9 bits (63), Expect = 6.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 78 VQIPQWYHEADVEKEEKIFLDSDKYQQG 161 VQIP W+ D K+E +F ++Q G Sbjct: 34 VQIPDWFSGKDARKKEAVFGQLPQFQDG 61
>HXC6_XENLA (P02832) Homeobox protein Hox-C6 (XlHbox-1) (AC1) [Contains:| Homeobox protein Hox-C6 PRII; Homeobox protein Hox-C6 PRI] Length = 234 Score = 28.9 bits (63), Expect = 6.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 165 AKSAQGRVYSNP*FTPNKNVATFSSVG 245 A AQ R+YS+P +TP NV SS G Sbjct: 42 AAVAQNRIYSSPFYTPQDNVVFGSSRG 68
>VL1_HPV18 (P06794) Major capsid protein L1| Length = 568 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 108 DVEKEEKIFLDSDKYQQGRAKSAQGRVYSNP*FTPNKNVATFSSVGSPP 254 +V+ +EK LD D+Y GR Q + P P K A ++ S P Sbjct: 510 NVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKP 558 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,670,594 Number of Sequences: 219361 Number of extensions: 1247397 Number of successful extensions: 3012 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3011 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)