Clone Name | rbastl50e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DPOLZ_HUMAN (O60673) DNA polymerase zeta catalytic subunit (EC 2... | 29 | 3.8 |
---|
>DPOLZ_HUMAN (O60673) DNA polymerase zeta catalytic subunit (EC 2.7.7.7) (hREV3)| Length = 3130 Score = 29.3 bits (64), Expect = 3.8 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +1 Query: 70 LNGKLRPDSSVQTIAGVCSYSFLS------LQCPCSKQHHSIINS*LNTWAGEG*C 219 LNG RP S V+ + + +FL + PCS+ ++ S +NT A G C Sbjct: 2139 LNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKC 2194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,724,402 Number of Sequences: 219361 Number of extensions: 1199952 Number of successful extensions: 2086 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2086 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)