Clone Name | rbastl50d10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SCD5_YEAST (P34758) Protein SCD5 (Protein FTB1) | 33 | 0.14 | 2 | CO1A1_MOUSE (P11087) Collagen alpha-1(I) chain precursor | 31 | 0.93 | 3 | CO1A1_RAT (P02454) Collagen alpha-1(I) chain precursor | 30 | 1.6 | 4 | LPXB_BLOFL (Q7VRD3) Lipid-A-disaccharide synthase (EC 2.4.1.182) | 28 | 7.8 |
---|
>SCD5_YEAST (P34758) Protein SCD5 (Protein FTB1)| Length = 872 Score = 33.5 bits (75), Expect = 0.14 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Frame = +1 Query: 16 TVNKKVRFEDSNKS*LNHIQTGGVSVPYPTMQQHYVSHLLA----FPDPTTRQIIVKTSH 183 T + VR + N + ++ G P T+ QH SHLL+ P Q+I + Sbjct: 568 TYSNNVRINNGNIVSMPKVEITGAFPPQNTLPQHQQSHLLSPQNTIPQHQRSQLISPQNT 627 Query: 184 FNTGRPTMQPQ 216 F +P + PQ Sbjct: 628 FTQNQPILSPQ 638
>CO1A1_MOUSE (P11087) Collagen alpha-1(I) chain precursor| Length = 1453 Score = 30.8 bits (68), Expect = 0.93 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -2 Query: 255 VPLSLFLHLGFTYLRLHGRAPCIKVTCLHYNL--PSRWIWKSKQMGYVVLLHSG 100 V L L L LG T L HG+ +V+C+H L P+ WK ++ + + H+G Sbjct: 5 VDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWK-PEVCLICICHNG 57
>CO1A1_RAT (P02454) Collagen alpha-1(I) chain precursor| Length = 1453 Score = 30.0 bits (66), Expect = 1.6 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 255 VPLSLFLHLGFTYLRLHGRAPCIKVTCLHYNL--PSRWIWKSKQMGYVVLLHSG 100 V L L L LG T L HG+ +V+C+H L P+ WK + + + H+G Sbjct: 5 VDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWK-PDVCLICICHNG 57
>LPXB_BLOFL (Q7VRD3) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 384 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 249 LSLFLHLGFT--YLRLHGRAPCIKVTCLHYNLPSRWIWKSKQM 127 L++F+ + F + L R +T +HY PS W W+S ++ Sbjct: 91 LNIFIGIDFPDFNISLEKRLKKYGITTIHYVSPSIWAWRSNRV 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,939,742 Number of Sequences: 219361 Number of extensions: 831155 Number of successful extensions: 1896 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1895 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)