ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl50d08 |
|---|---|
| Clone Library Name | barley_pub |
>MBD4_HUMAN (O95243) Methyl-CpG-binding domain protein 4 (EC 3.2.2.-)| (Methyl-CpG-binding protein MBD4) (Methyl-CpG-binding endonuclease 1) (Mismatch-specific DNA N-glycosylase) Length = 580 Score = 57.0 bits (136), Expect = 2e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = -3 Query: 431 VRTRNIKKLSKQYVGNEWTHVTQLCGVGKYAADAYAIFCAGRAREVVPDDHKLVDYWNYV 252 +R + I K S +Y+ +W + +L G+GKY D+Y IFC ++V P+DHKL Y +++ Sbjct: 511 LRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 570
>MBD4_MOUSE (Q9Z2D7) Methyl-CpG-binding domain protein 4 (EC 3.2.2.-)| (Methyl-CpG-binding protein MBD4) (Mismatch-specific DNA N-glycosylase) Length = 554 Score = 56.6 bits (135), Expect = 2e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = -3 Query: 431 VRTRNIKKLSKQYVGNEWTHVTQLCGVGKYAADAYAIFCAGRAREVVPDDHKLVDYWNYV 252 +R + I K S +Y+ +W + +L G+GKY D+Y IFC ++V P+DHKL Y +++ Sbjct: 485 LRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 544
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 32.0 bits (71), Expect = 0.65 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 257 NSSNQLTCDHQVPPPSPYPHKILHKHQLH 343 NS N L PPP P+PH H H LH Sbjct: 272 NSYNGLGGPPAAPPPPPHPHPHPHAHHLH 300
>YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 intergenic| region Length = 396 Score = 31.2 bits (69), Expect = 1.1 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +2 Query: 218 TNPSVPWATQS--RHNSSNQLTCDHQVPPPSPYPHKILHKHQLHTCRR 355 TNP++P S N Q +PPP P + LH H LHT R Sbjct: 238 TNPNIPSTMTSILSFNRDQQQPLSQPLPPP-PQQQQDLHTHNLHTIPR 284
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 31.2 bits (69), Expect = 1.1 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +2 Query: 179 ASPCTSLNIYWN*TNPSVPWATQSRHNSSNQLTCDHQVPPPSPYPHKILHKHQLH 343 A P S Y + ++P + +N PPP P+PH H H LH Sbjct: 245 AGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPPPHPHPHPHAHHLH 299
>GLNA2_MYCTU (P64245) Probable glutamine synthetase 2 (EC 6.3.1.2)| (Glutamate--ammonia ligase 2) Length = 446 Score = 30.8 bits (68), Expect = 1.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 230 VPWATQSRHNSSNQLTCDHQVPPPSP 307 +PWAT S H+ S ++ CD +P SP Sbjct: 79 LPWATSSGHHHSARMFCDITMPDGSP 104
>GLNA2_MYCBO (P64246) Probable glutamine synthetase 2 (EC 6.3.1.2)| (Glutamate--ammonia ligase 2) Length = 446 Score = 30.8 bits (68), Expect = 1.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 230 VPWATQSRHNSSNQLTCDHQVPPPSP 307 +PWAT S H+ S ++ CD +P SP Sbjct: 79 LPWATSSGHHHSARMFCDITMPDGSP 104
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 28.9 bits (63), Expect = 5.5 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 164 PPSTAASPCTSLNIYWN*TNPSVPWATQSRHNSSNQLT-CDHQVPPPSPYP 313 PP+T SP S + + +NP+V T R + N L D + P +P P Sbjct: 411 PPTTTGSPTPSSRVVMSPSNPTVFKITVGRAPTENLLNIVDQEQHPSTPEP 461
>SYN2_RAT (Q63537) Synapsin-2 (Synapsin II)| Length = 586 Score = 28.5 bits (62), Expect = 7.2 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = +2 Query: 164 PPSTAASPCTSLNIYWN*TNPSVPWATQSRHNSSNQLTCDHQVP----PPSPYPHKILHK 331 PPS+++S +S + P P +TQ +SS+ + Q P P P PH L+K Sbjct: 485 PPSSSSSSSSSSSSSAP-QRPGGPTSTQVNASSSSNSLAEPQAPQAAPPQKPQPHPQLNK 543 Query: 332 HQ 337 Q Sbjct: 544 SQ 545
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.1 bits (61), Expect = 9.4 Identities = 22/69 (31%), Positives = 27/69 (39%) Frame = +2 Query: 116 PTPVAL*NYPIQDCMAPPSTAASPCTSLNIYWN*TNPSVPWATQSRHNSSNQLTCDHQVP 295 P+PV P+ APPS A SP S P+ P + S S + P Sbjct: 311 PSPVPPSPAPVPPSPAPPSPAPSPPPS---------PAPPTPSPSPSPSPSPSPSPSPSP 361 Query: 296 PPSPYPHKI 322 PSP P I Sbjct: 362 SPSPSPSPI 370
>PHLA1_RAT (Q9QZA1) Pleckstrin homology-like domain family A member 1| (Proline- and glutamine-rich protein) (PQR protein) Length = 263 Score = 28.1 bits (61), Expect = 9.4 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +2 Query: 284 HQVPPPSPYPHKILHKHQ-LHT 346 H P P P+PH++ H HQ LH+ Sbjct: 227 HPHPHPHPHPHQLQHAHQPLHS 248
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 28.1 bits (61), Expect = 9.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 284 HQVPPPSPYPHKILHKHQL 340 HQ+P P P PH H H+L Sbjct: 233 HQIPHPHPQPHSQPHGHRL 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,454,597 Number of Sequences: 219361 Number of extensions: 1365160 Number of successful extensions: 3930 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3910 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
