Clone Name | rbastl50d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNAC_BACSU (P94481) Hypothetical protein ynaC | 28 | 6.2 |
---|
>YNAC_BACSU (P94481) Hypothetical protein ynaC| Length = 263 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 106 VKSCMSSTVITHPPSLVLSIYCTYNRHHHELSLSTSSF 219 VK + T+P S++LS YC YNR++ +S + F Sbjct: 24 VKKTLQEKYGTNPDSIILSDYC-YNRYNKGISFNKHLF 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,859,326 Number of Sequences: 219361 Number of extensions: 618620 Number of successful extensions: 2136 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2135 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)